Detailed information NTG0479499

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: IBC08_RS08765
• Genome accession: NZ_CP061019
• Coordinates: 1693969..1694295 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain 24853
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1688969..1699295

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IBC08_RS10130	-	1689237..1689662 (-)	426	WP_087010196.1	CPBP family intramembrane glutamic endopeptidase	-
IBC08_RS08730 (IBC08_08700)	-	1689904..1690101 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
IBC08_RS08735 (IBC08_08705)	-	1690350..1691543 (-)	1194	WP_084831204.1	acetate kinase	-
IBC08_RS08740 (IBC08_08710)	comYH	1691599..1692555 (-)	957	WP_207559851.1	class I SAM-dependent methyltransferase	Machinery gene
IBC08_RS08745 (IBC08_08715)	comGG	1692600..1692917 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
IBC08_RS08750 (IBC08_08720)	comYF	1692895..1693332 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
IBC08_RS08755 (IBC08_08725)	comGE	1693316..1693609 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
IBC08_RS08760 (IBC08_08730)	comYD	1693581..1694009 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
IBC08_RS08765 (IBC08_08735)	comYC	1693969..1694295 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
IBC08_RS08770 (IBC08_08740)	comYB	1694292..1695392 (-)	1101	WP_207559852.1	competence type IV pilus assembly protein ComGB	Machinery gene
IBC08_RS08775 (IBC08_08745)	comGA/cglA/cilD	1695274..1696215 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
IBC08_RS08780 (IBC08_08750)	-	1696296..1696658 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=479499 IBC08_RS08765 WP_002946126.1 1693969..1694295(-) (comYC) [Streptococcus thermophilus strain 24853]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=479499 IBC08_RS08765 WP_002946126.1 1693969..1694295(-) (comYC) [Streptococcus thermophilus strain 24853]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAAGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361