NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	H9Q14_RS09285	Genome accession	NZ_CP060794
Coordinates	1955551..1955868 (-)	Length	105 a.a.
NCBI ID	WP_001831271.1	Uniprot ID	A0A9Q5JKE9
Organism	Staphylococcus epidermidis strain Z0118SE0260
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1950551..1960868

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H9Q14_RS09255	gcvPA	1951077..1952423 (-)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
H9Q14_RS09260	gcvT	1952443..1953534 (-)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
H9Q14_RS09265	-	1953752..1954264 (-)	513	WP_002440040.1	shikimate kinase	-
H9Q14_RS09270	-	1954429..1954920 (-)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
H9Q14_RS09275	-	1954844..1955137 (-)	294	WP_001831116.1	hypothetical protein	-
H9Q14_RS09280	comGD	1955124..1955561 (-)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
H9Q14_RS09285	comGC	1955551..1955868 (-)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
H9Q14_RS09290	comGB	1955886..1956953 (-)	1068	WP_001831131.1	competence type IV pilus assembly protein ComGB	Machinery gene
H9Q14_RS09295	comGA	1956925..1957899 (-)	975	WP_151368235.1	competence type IV pilus ATPase ComGA	Machinery gene
H9Q14_RS09300	-	1957956..1958579 (-)	624	WP_001831016.1	MBL fold metallo-hydrolase	-
H9Q14_RS09305	-	1958579..1958905 (-)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
H9Q14_RS09310	-	1958905..1959891 (-)	987	WP_001831113.1	ROK family glucokinase	-
H9Q14_RS09315	-	1959891..1960091 (-)	201	WP_001831138.1	YqgQ family protein	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11491.58 Da Isoelectric Point: 9.7429

                                >NTDB_id=478380 H9Q14_RS09285 WP_001831271.1 1955551..1955868(-) (comGC) [Staphylococcus epidermidis strain Z0118SE0260]

MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG

FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

Download Length: 318 bp

                                >NTDB_id=478380 H9Q14_RS09285 WP_001831271.1 1955551..1955868(-) (comGC) [Staphylococcus epidermidis strain Z0118SE0260]

ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT

ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA

TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT

TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362

Detailed information NTG0478380