Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FOC63_RS06200 | Genome accession | NZ_CP054015 |
| Coordinates | 1223074..1223517 (+) | Length | 147 a.a. |
| NCBI ID | WP_009853511.1 | Uniprot ID | - |
| Organism | Streptococcus gallolyticus strain FDAARGOS_755 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1206169..1251456 | 1223074..1223517 | within | 0 |
Gene organization within MGE regions
Location: 1206169..1251456
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC63_RS06080 (FOC63_06080) | - | 1206169..1206912 (+) | 744 | WP_009853486.1 | amino acid ABC transporter ATP-binding protein | - |
| FOC63_RS06085 (FOC63_06085) | - | 1207003..1207227 (+) | 225 | WP_009853487.1 | DUF4059 family protein | - |
| FOC63_RS06090 (FOC63_06090) | trxB | 1207291..1208205 (+) | 915 | WP_009853488.1 | thioredoxin-disulfide reductase | - |
| FOC63_RS06095 (FOC63_06095) | - | 1208503..1209663 (-) | 1161 | WP_009853489.1 | tyrosine-type recombinase/integrase | - |
| FOC63_RS06100 (FOC63_06100) | - | 1210003..1211598 (-) | 1596 | WP_009853490.1 | SIR2 family protein | - |
| FOC63_RS06105 (FOC63_06105) | - | 1211849..1212310 (-) | 462 | WP_043878514.1 | TM2 domain-containing protein | - |
| FOC63_RS06110 (FOC63_06110) | - | 1212364..1213104 (-) | 741 | WP_009853492.1 | hypothetical protein | - |
| FOC63_RS06115 (FOC63_06115) | - | 1213107..1213844 (-) | 738 | WP_009853493.1 | XRE family transcriptional regulator | - |
| FOC63_RS06120 (FOC63_06120) | - | 1214210..1214368 (+) | 159 | WP_009853494.1 | hypothetical protein | - |
| FOC63_RS06125 (FOC63_06125) | - | 1214511..1215002 (-) | 492 | WP_043878515.1 | hypothetical protein | - |
| FOC63_RS06130 (FOC63_06130) | - | 1215060..1215272 (+) | 213 | WP_009853496.1 | helix-turn-helix transcriptional regulator | - |
| FOC63_RS06135 (FOC63_06135) | - | 1215301..1216188 (+) | 888 | WP_009853497.1 | DUF3102 domain-containing protein | - |
| FOC63_RS06140 (FOC63_06140) | - | 1216191..1217030 (+) | 840 | WP_009853498.1 | ParB N-terminal domain-containing protein | - |
| FOC63_RS06145 (FOC63_06145) | - | 1217436..1217705 (+) | 270 | WP_009853499.1 | hypothetical protein | - |
| FOC63_RS06150 (FOC63_06150) | - | 1217640..1218446 (-) | 807 | WP_009853500.1 | TIGR02391 family protein | - |
| FOC63_RS06155 (FOC63_06155) | - | 1218496..1218696 (+) | 201 | WP_009853501.1 | ATP synthase F0 subunit B | - |
| FOC63_RS06160 (FOC63_06160) | - | 1218680..1219039 (-) | 360 | WP_009853502.1 | hypothetical protein | - |
| FOC63_RS06165 (FOC63_06165) | - | 1219140..1219391 (+) | 252 | WP_043878516.1 | hypothetical protein | - |
| FOC63_RS06170 (FOC63_06170) | - | 1219676..1220578 (+) | 903 | WP_009853505.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FOC63_RS06175 (FOC63_06175) | - | 1220581..1220835 (+) | 255 | WP_009853506.1 | hypothetical protein | - |
| FOC63_RS06180 (FOC63_06180) | - | 1220835..1221056 (+) | 222 | WP_009853507.1 | hypothetical protein | - |
| FOC63_RS06185 (FOC63_06185) | - | 1221056..1221310 (+) | 255 | WP_009853508.1 | hypothetical protein | - |
| FOC63_RS06190 (FOC63_06190) | bet | 1221322..1222053 (+) | 732 | WP_009853509.1 | phage recombination protein Bet | - |
| FOC63_RS06195 (FOC63_06195) | - | 1222067..1223065 (+) | 999 | WP_009853510.1 | DUF1351 domain-containing protein | - |
| FOC63_RS06200 (FOC63_06200) | ssbA | 1223074..1223517 (+) | 444 | WP_009853511.1 | single-stranded DNA-binding protein | Machinery gene |
| FOC63_RS06205 (FOC63_06205) | - | 1223529..1223975 (+) | 447 | WP_009853512.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FOC63_RS06210 (FOC63_06210) | - | 1224112..1224372 (+) | 261 | WP_009853514.1 | PIN domain protein | - |
| FOC63_RS06215 (FOC63_06215) | - | 1224426..1224596 (+) | 171 | WP_155734604.1 | hypothetical protein | - |
| FOC63_RS06220 (FOC63_06220) | - | 1224589..1224753 (+) | 165 | WP_172855741.1 | hypothetical protein | - |
| FOC63_RS06225 (FOC63_06225) | - | 1224746..1225276 (+) | 531 | WP_009853517.1 | DUF1642 domain-containing protein | - |
| FOC63_RS06230 (FOC63_06230) | - | 1225437..1225823 (+) | 387 | WP_009853519.1 | YopX family protein | - |
| FOC63_RS06235 (FOC63_06235) | - | 1225820..1226068 (+) | 249 | WP_009853520.1 | hypothetical protein | - |
| FOC63_RS06240 (FOC63_06240) | - | 1226789..1227199 (+) | 411 | WP_009853522.1 | DUF1492 domain-containing protein | - |
| FOC63_RS06245 (FOC63_06245) | - | 1227377..1227985 (+) | 609 | WP_009853523.1 | hypothetical protein | - |
| FOC63_RS06250 (FOC63_06250) | - | 1228098..1228529 (+) | 432 | WP_009853524.1 | terminase small subunit | - |
| FOC63_RS06255 (FOC63_06255) | - | 1228519..1229769 (+) | 1251 | WP_009853525.1 | PBSX family phage terminase large subunit | - |
| FOC63_RS06260 (FOC63_06260) | - | 1229781..1231313 (+) | 1533 | WP_009853526.1 | phage portal protein | - |
| FOC63_RS06265 (FOC63_06265) | - | 1231282..1232250 (+) | 969 | WP_009853527.1 | minor capsid protein | - |
| FOC63_RS06270 (FOC63_06270) | - | 1232267..1232413 (+) | 147 | WP_009853528.1 | hypothetical protein | - |
| FOC63_RS06280 (FOC63_06280) | - | 1232705..1233349 (+) | 645 | WP_009853529.1 | DUF4355 domain-containing protein | - |
| FOC63_RS06285 (FOC63_06285) | - | 1233362..1233739 (+) | 378 | WP_009853530.1 | hypothetical protein | - |
| FOC63_RS06290 (FOC63_06290) | - | 1233744..1234793 (+) | 1050 | WP_009853531.1 | major capsid protein | - |
| FOC63_RS06295 (FOC63_06295) | - | 1234809..1234958 (+) | 150 | WP_009853532.1 | hypothetical protein | - |
| FOC63_RS06300 (FOC63_06300) | - | 1234967..1235311 (+) | 345 | WP_009853533.1 | phage head-tail connector protein | - |
| FOC63_RS06305 (FOC63_06305) | - | 1235308..1235625 (+) | 318 | WP_009853534.1 | hypothetical protein | - |
| FOC63_RS06310 (FOC63_06310) | - | 1235618..1235971 (+) | 354 | WP_009853535.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FOC63_RS06315 (FOC63_06315) | - | 1235961..1236350 (+) | 390 | WP_009853536.1 | hypothetical protein | - |
| FOC63_RS06320 (FOC63_06320) | - | 1236360..1236842 (+) | 483 | WP_009853537.1 | phage major tail protein, TP901-1 family | - |
| FOC63_RS06325 (FOC63_06325) | - | 1236895..1237245 (+) | 351 | WP_009853538.1 | tail assembly chaperone | - |
| FOC63_RS06330 (FOC63_06330) | - | 1237281..1237631 (+) | 351 | WP_172855742.1 | hypothetical protein | - |
| FOC63_RS06335 (FOC63_06335) | - | 1237624..1240707 (+) | 3084 | WP_009853540.1 | phage tail tape measure protein | - |
| FOC63_RS06340 (FOC63_06340) | - | 1240700..1241578 (+) | 879 | WP_009853541.1 | distal tail protein Dit | - |
| FOC63_RS06345 (FOC63_06345) | - | 1241657..1242256 (+) | 600 | WP_009853542.1 | hypothetical protein | - |
| FOC63_RS06350 (FOC63_06350) | - | 1242253..1246629 (+) | 4377 | WP_009853543.1 | hypothetical protein | - |
| FOC63_RS06355 (FOC63_06355) | - | 1246645..1246980 (+) | 336 | WP_009853544.1 | hypothetical protein | - |
| FOC63_RS06360 (FOC63_06360) | - | 1246996..1247271 (+) | 276 | WP_009853545.1 | DUF7365 family protein | - |
| FOC63_RS06365 (FOC63_06365) | - | 1247268..1247531 (+) | 264 | WP_009853546.1 | hypothetical protein | - |
| FOC63_RS06370 (FOC63_06370) | - | 1247521..1248804 (+) | 1284 | WP_009853547.1 | LysM peptidoglycan-binding domain-containing protein | - |
| FOC63_RS06375 (FOC63_06375) | - | 1249077..1249505 (+) | 429 | WP_009853548.1 | Panacea domain-containing protein | - |
| FOC63_RS06380 (FOC63_06380) | - | 1249492..1250550 (+) | 1059 | WP_009853549.1 | hypothetical protein | - |
| FOC63_RS06385 (FOC63_06385) | - | 1250872..1251456 (+) | 585 | WP_043878633.1 | MarC family protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16298.98 Da Isoelectric Point: 5.1169
>NTDB_id=450157 FOC63_RS06200 WP_009853511.1 1223074..1223517(+) (ssbA) [Streptococcus gallolyticus strain FDAARGOS_755]
MNNVNLIGRLTKAPELKQTASNTSVLTGTLAVNRTFKSQNGEREADFINIVAWRQTAEIIAQYCGKGSQIGITGRIQTRN
YENQQGQRVYVTEVVAEHVDLLDGKSDGQQGQSNGYNQQPQQNSYMQQGNPFGNSNPMDISDDMLPF
MNNVNLIGRLTKAPELKQTASNTSVLTGTLAVNRTFKSQNGEREADFINIVAWRQTAEIIAQYCGKGSQIGITGRIQTRN
YENQQGQRVYVTEVVAEHVDLLDGKSDGQQGQSNGYNQQPQQNSYMQQGNPFGNSNPMDISDDMLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=450157 FOC63_RS06200 WP_009853511.1 1223074..1223517(+) (ssbA) [Streptococcus gallolyticus strain FDAARGOS_755]
ATGAACAACGTAAATCTAATCGGTCGCTTAACAAAAGCGCCAGAATTAAAACAAACAGCGAGCAACACAAGCGTATTAAC
AGGAACGCTTGCTGTAAATCGCACATTTAAGAGCCAAAACGGCGAACGTGAAGCAGACTTCATTAATATTGTCGCTTGGC
GACAAACAGCGGAAATCATCGCACAATATTGCGGCAAAGGTTCGCAAATTGGAATTACTGGTCGTATTCAGACACGTAAC
TATGAGAATCAGCAAGGACAGCGTGTGTATGTAACTGAAGTAGTAGCTGAACACGTCGACTTGCTAGATGGCAAGAGCGA
CGGCCAGCAAGGACAGTCGAACGGTTACAATCAACAACCACAGCAAAACAGCTATATGCAGCAGGGAAATCCATTTGGTA
ATTCAAATCCAATGGACATTTCAGATGACATGCTACCGTTCTAA
ATGAACAACGTAAATCTAATCGGTCGCTTAACAAAAGCGCCAGAATTAAAACAAACAGCGAGCAACACAAGCGTATTAAC
AGGAACGCTTGCTGTAAATCGCACATTTAAGAGCCAAAACGGCGAACGTGAAGCAGACTTCATTAATATTGTCGCTTGGC
GACAAACAGCGGAAATCATCGCACAATATTGCGGCAAAGGTTCGCAAATTGGAATTACTGGTCGTATTCAGACACGTAAC
TATGAGAATCAGCAAGGACAGCGTGTGTATGTAACTGAAGTAGTAGCTGAACACGTCGACTTGCTAGATGGCAAGAGCGA
CGGCCAGCAAGGACAGTCGAACGGTTACAATCAACAACCACAGCAAAACAGCTATATGCAGCAGGGAAATCCATTTGGTA
ATTCAAATCCAATGGACATTTCAGATGACATGCTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.047 |
100 |
0.605 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.531 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.238 |
71.429 |
0.395 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.877 |
77.551 |
0.395 |
| ssb | Vibrio cholerae strain A1552 |
32.759 |
100 |
0.388 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.368 |
77.551 |
0.367 |
| ssb | Glaesserella parasuis strain SC1401 |
29.944 |
100 |
0.361 |
| ssbA | Streptococcus mutans UA159 |
45.69 |
78.912 |
0.361 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.491 |
77.551 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.491 |
77.551 |
0.361 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.491 |
77.551 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.491 |
77.551 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.491 |
77.551 |
0.361 |