Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SSUST3_RS02285 | Genome accession | NC_015433 |
| Coordinates | 435293..435691 (+) | Length | 132 a.a. |
| NCBI ID | WP_013730176.1 | Uniprot ID | - |
| Organism | Streptococcus suis ST3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 426855..447250 | 435293..435691 | within | 0 |
Gene organization within MGE regions
Location: 426855..447250
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSUST3_RS02205 (SSUST3_0431) | - | 426855..428012 (-) | 1158 | WP_013730163.1 | tyrosine-type recombinase/integrase | - |
| SSUST3_RS02210 (SSUST3_0432) | - | 428209..428940 (-) | 732 | WP_013730164.1 | hypothetical protein | - |
| SSUST3_RS02215 (SSUST3_0433) | - | 428988..429371 (-) | 384 | WP_013730165.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SSUST3_RS02220 (SSUST3_0434) | - | 429378..429926 (-) | 549 | WP_022540560.1 | helix-turn-helix domain-containing protein | - |
| SSUST3_RS02225 (SSUST3_0435) | - | 429943..430143 (+) | 201 | WP_002937001.1 | helix-turn-helix domain-containing protein | - |
| SSUST3_RS02230 (SSUST3_0436) | - | 430213..430539 (+) | 327 | WP_013730166.1 | hypothetical protein | - |
| SSUST3_RS02235 (SSUST3_0437) | - | 430613..430867 (+) | 255 | WP_013730167.1 | hypothetical protein | - |
| SSUST3_RS02240 (SSUST3_0438) | - | 430908..431156 (+) | 249 | WP_013730168.1 | hypothetical protein | - |
| SSUST3_RS10610 | - | 431146..431298 (+) | 153 | WP_022540561.1 | hypothetical protein | - |
| SSUST3_RS02245 (SSUST3_0439) | - | 431303..431644 (+) | 342 | WP_013730169.1 | hypothetical protein | - |
| SSUST3_RS02250 (SSUST3_0440) | - | 431644..432123 (+) | 480 | WP_013730170.1 | siphovirus Gp157 family protein | - |
| SSUST3_RS02255 (SSUST3_0441) | - | 432120..432365 (+) | 246 | WP_013730171.1 | hypothetical protein | - |
| SSUST3_RS02260 (SSUST3_0442) | - | 432346..432810 (+) | 465 | WP_013730172.1 | hypothetical protein | - |
| SSUST3_RS02265 (SSUST3_0443) | - | 432779..433951 (+) | 1173 | WP_013730173.1 | DEAD/DEAH box helicase family protein | - |
| SSUST3_RS02270 (SSUST3_0444) | - | 433972..434292 (+) | 321 | WP_013730174.1 | hypothetical protein | - |
| SSUST3_RS02275 (SSUST3_0445) | - | 434302..435000 (+) | 699 | WP_013730175.1 | ERF family protein | - |
| SSUST3_RS02280 | - | 435000..435296 (+) | 297 | WP_022540564.1 | hypothetical protein | - |
| SSUST3_RS02285 (SSUST3_0446) | ssbA | 435293..435691 (+) | 399 | WP_013730176.1 | single-stranded DNA-binding protein | Machinery gene |
| SSUST3_RS02290 (SSUST3_0447) | - | 435702..436529 (+) | 828 | WP_013730177.1 | bifunctional DNA primase/polymerase | - |
| SSUST3_RS02295 (SSUST3_0448) | - | 436513..437892 (+) | 1380 | WP_079253058.1 | virulence-associated E family protein | - |
| SSUST3_RS10680 (SSUST3_0449) | - | 438270..438425 (+) | 156 | WP_013730179.1 | DUF7204 family protein | - |
| SSUST3_RS02300 (SSUST3_0450) | - | 438422..438730 (+) | 309 | WP_013730180.1 | DUF1372 family protein | - |
| SSUST3_RS02305 (SSUST3_0451) | - | 438732..438947 (+) | 216 | WP_013730181.1 | hypothetical protein | - |
| SSUST3_RS02310 (SSUST3_0452) | - | 439136..439450 (+) | 315 | WP_013730182.1 | hypothetical protein | - |
| SSUST3_RS02315 (SSUST3_0453) | - | 439523..439957 (+) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| SSUST3_RS02320 (SSUST3_0454) | - | 440054..440401 (+) | 348 | WP_013730183.1 | HNH endonuclease | - |
| SSUST3_RS02325 (SSUST3_0455) | - | 440606..440851 (+) | 246 | WP_022540566.1 | hypothetical protein | - |
| SSUST3_RS02330 (SSUST3_0456) | - | 440848..442113 (+) | 1266 | WP_013730185.1 | phage portal protein | - |
| SSUST3_RS10685 (SSUST3_0457) | - | 442106..443326 (+) | 1221 | WP_013730186.1 | hypothetical protein | - |
| SSUST3_RS02340 | - | 443331..443564 (+) | 234 | WP_022540567.1 | hypothetical protein | - |
| SSUST3_RS02345 (SSUST3_0459) | - | 444265..444471 (-) | 207 | WP_041179173.1 | DUF1492 domain-containing protein | - |
| SSUST3_RS02350 (SSUST3_0460) | - | 445269..445901 (-) | 633 | WP_004194123.1 | YigZ family protein | - |
| SSUST3_RS02355 (SSUST3_0461) | comFA/cflA | 445958..447250 (+) | 1293 | WP_004194121.1 | DEAD/DEAH box helicase | Machinery gene |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14853.40 Da Isoelectric Point: 4.6558
>NTDB_id=40536 SSUST3_RS02285 WP_013730176.1 435293..435691(+) (ssbA) [Streptococcus suis ST3]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWHQQAENLANWGKKGALIGVTGRIQTR
TYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWHQQAENLANWGKKGALIGVTGRIQTR
TYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=40536 SSUST3_RS02285 WP_013730176.1 435293..435691(+) (ssbA) [Streptococcus suis ST3]
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCATCAACAAGCTGAGAATTTGGCGAATTGGGGTAAGAAAGGTGCTCTGATTGGAGTTACAGGTCGCATTCAGACTCGT
ACCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCATCAACAAGCTGAGAATTTGGCGAATTGGGGTAAGAAAGGTGCTCTGATTGGAGTTACAGGTCGCATTCAGACTCGT
ACCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.682 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.667 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.485 |
100 |
0.485 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.455 |
100 |
0.455 |
| ssbA | Streptococcus mutans UA159 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.697 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.697 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.697 |
100 |
0.447 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.697 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.697 |
100 |
0.447 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.294 |
82.576 |
0.432 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.17 |
80.303 |
0.379 |
| ssb | Vibrio cholerae strain A1552 |
28.324 |
100 |
0.371 |