Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSNT_RS16240 Genome accession   NC_017196
Coordinates   3018705..3018845 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto BEST195     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3013705..3023845
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSNT_RS16215 (BSNT_04660) yuxO 3013982..3014362 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BSNT_RS16220 (BSNT_04661) comA 3014381..3015025 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSNT_RS16225 (BSNT_04664) comP 3015106..3017418 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  BSNT_RS16230 (BSNT_04665) comX 3017434..3017655 (-) 222 WP_014480704.1 competence pheromone ComX -
  BSNT_RS16235 (BSNT_04666) comQ 3017657..3018520 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  BSNT_RS16240 (BSNT_04667) degQ 3018705..3018845 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSNT_RS22890 (BSNT_04668) - 3019067..3019192 (+) 126 WP_003228793.1 hypothetical protein -
  BSNT_RS16245 (BSNT_04669) - 3019306..3019674 (+) 369 WP_014477834.1 hypothetical protein -
  BSNT_RS16250 (BSNT_04670) pdeH 3019650..3020879 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  BSNT_RS16255 (BSNT_04671) pncB 3021015..3022487 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  BSNT_RS16260 (BSNT_04672) pncA 3022503..3023054 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  BSNT_RS16265 (BSNT_04673) yueI 3023151..3023549 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=36179 BSNT_RS16240 WP_003220708.1 3018705..3018845(-) (degQ) [Bacillus subtilis subsp. natto BEST195]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=36179 BSNT_RS16240 WP_003220708.1 3018705..3018845(-) (degQ) [Bacillus subtilis subsp. natto BEST195]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment