NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	GNT62_RS27565	Genome accession	NZ_CP046406
Coordinates	5750170..5750634 (-)	Length	154 a.a.
NCBI ID	WP_031630343.1	Uniprot ID	Q93PL5
Organism	Pseudomonas aeruginosa strain SE5458
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 5745170..5755634

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GNT62_RS27545 (GNT62_27465)	ampD	5745860..5746426 (-)	567	WP_003094640.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
GNT62_RS27550 (GNT62_27470)	-	5746577..5748832 (-)	2256	WP_003094643.1	DUF1631 domain-containing protein	-
GNT62_RS27555 (GNT62_27475)	nadC	5749118..5749966 (+)	849	WP_003094645.1	carboxylating nicotinate-nucleotide diphosphorylase	-
GNT62_RS27565 (GNT62_27485)	pilA	5750170..5750634 (-)	465	WP_031630343.1	pilin	Machinery gene
GNT62_RS27570 (GNT62_27490)	pilB	5750864..5752564 (+)	1701	WP_003094647.1	type IV-A pilus assembly ATPase PilB	Machinery gene
GNT62_RS27575 (GNT62_27495)	pilC	5752568..5753788 (+)	1221	WP_003094649.1	type II secretion system F family protein	Machinery gene
GNT62_RS27580 (GNT62_27500)	pilD	5753792..5754664 (+)	873	WP_003094651.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
GNT62_RS27585 (GNT62_27505)	coaE	5754661..5755272 (+)	612	WP_003094654.1	dephospho-CoA kinase	-
GNT62_RS27590 (GNT62_27510)	yacG	5755269..5755469 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 154 a.a. Molecular weight: 15780.91 Da Isoelectric Point: 6.1571

                                >NTDB_id=352098 GNT62_RS27565 WP_031630343.1 5750170..5750634(-) (pilA) [Pseudomonas aeruginosa strain SE5458]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVSRSQVSRVMAEAGSLKTAVEACLQDGRTAVGTAAGQCDPGATGSSL

LTGASQTSQTLPTNTGVPQVLDPLTTQTTIIATFGNGASAAISGQTLTWTRDVNGGWSCATTVDAKFRPNGCTD

Nucleotide

Download Length: 465 bp

                                >NTDB_id=352098 GNT62_RS27565 WP_031630343.1 5750170..5750634(-) (pilA) [Pseudomonas aeruginosa strain SE5458]

ATGAAAGCACAGAAGGGTTTTACTCTGATTGAACTGATGATCGTAGTTGCGATCATTGGTATTCTGGCTGCAATCGCAAT

TCCCCAATATCAGAACTATGTTTCTCGCTCTCAGGTCTCCAGGGTTATGGCAGAGGCTGGCTCCTTGAAGACTGCAGTTG

AGGCCTGCCTCCAGGATGGTCGTACTGCTGTGGGTACTGCTGCTGGTCAATGCGACCCGGGTGCGACGGGTTCCAGTTTG

TTGACTGGTGCTTCTCAGACTTCTCAAACCCTGCCAACCAATACCGGTGTTCCGCAGGTTCTGGATCCTCTGACTACTCA

AACCACTATCATTGCGACTTTTGGTAACGGTGCATCCGCAGCTATTTCTGGCCAGACTCTGACCTGGACTCGTGATGTTA

ATGGTGGCTGGAGCTGTGCTACTACCGTAGATGCTAAATTCCGTCCTAATGGCTGTACTGACTGA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Pilin (bacterial filament) (Pilin)

(35-153)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q93PL5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	46.753	100	0.468
pilA	Vibrio cholerae strain A1552	43.59	100	0.442
pilA	Vibrio cholerae C6706	43.59	100	0.442
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	43.59	100	0.442
comP	Acinetobacter baylyi ADP1	40.12	100	0.435
pilA	Vibrio parahaemolyticus RIMD 2210633	40.881	100	0.422
pilA	Acinetobacter baumannii strain A118	41.83	99.351	0.416
pilA2	Legionella pneumophila strain ERS1305867	41.558	100	0.416
pilA2	Legionella pneumophila str. Paris	40.909	100	0.409
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40	100	0.403
pilE	Neisseria gonorrhoeae MS11	33.908	100	0.383
pilA/pilAII	Pseudomonas stutzeri DSM 10701	38.411	98.052	0.377

Detailed information NTG0352098