Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ETT50_RS03275 | Genome accession | NZ_CP035449 |
| Coordinates | 625288..625713 (+) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm56 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 613819..658426 | 625288..625713 | within | 0 |
Gene organization within MGE regions
Location: 613819..658426
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT50_RS03180 (ETT50_03180) | - | 613837..614679 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| ETT50_RS03185 (ETT50_03185) | - | 614657..615244 (+) | 588 | WP_010922482.1 | YpmS family protein | - |
| ETT50_RS03190 (ETT50_03190) | - | 615343..615618 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT50_RS03195 (ETT50_03195) | - | 615707..616849 (-) | 1143 | WP_032465117.1 | site-specific integrase | - |
| ETT50_RS03200 (ETT50_03200) | - | 616974..617279 (-) | 306 | WP_011106738.1 | membrane protein | - |
| ETT50_RS03205 (ETT50_03205) | - | 617289..618077 (-) | 789 | WP_030127591.1 | S24 family peptidase | - |
| ETT50_RS09390 | - | 618447..618596 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| ETT50_RS03210 (ETT50_03210) | - | 618582..618797 (-) | 216 | WP_014635530.1 | hypothetical protein | - |
| ETT50_RS03215 (ETT50_03215) | - | 618856..619014 (+) | 159 | WP_021340638.1 | hypothetical protein | - |
| ETT50_RS03220 (ETT50_03220) | - | 619113..619754 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| ETT50_RS03225 (ETT50_03225) | - | 619847..620086 (+) | 240 | WP_014411882.1 | helix-turn-helix transcriptional regulator | - |
| ETT50_RS03230 (ETT50_03230) | - | 620097..620858 (+) | 762 | WP_023610918.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT50_RS09510 | - | 620871..621002 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| ETT50_RS03235 (ETT50_03235) | - | 620999..621181 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| ETT50_RS03240 (ETT50_03240) | - | 621287..621598 (+) | 312 | WP_032465116.1 | hypothetical protein | - |
| ETT50_RS09515 | - | 621600..621734 (+) | 135 | WP_261729371.1 | hypothetical protein | - |
| ETT50_RS03245 (ETT50_03245) | - | 621856..622617 (+) | 762 | WP_014635613.1 | DnaD domain protein | - |
| ETT50_RS03250 (ETT50_03250) | - | 622604..623386 (+) | 783 | WP_032465115.1 | ATP-binding protein | - |
| ETT50_RS09395 | - | 623377..623514 (+) | 138 | WP_011018145.1 | hypothetical protein | - |
| ETT50_RS03255 (ETT50_03255) | - | 623525..623881 (+) | 357 | WP_021341157.1 | HTH domain-containing protein | - |
| ETT50_RS03260 (ETT50_03260) | - | 623862..624116 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| ETT50_RS03265 (ETT50_03265) | - | 624138..624620 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ETT50_RS03270 (ETT50_03270) | - | 624621..625295 (+) | 675 | WP_032465114.1 | ERF family protein | - |
| ETT50_RS03275 (ETT50_03275) | ssb | 625288..625713 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT50_RS03280 (ETT50_03280) | - | 625719..625922 (+) | 204 | WP_032465113.1 | hypothetical protein | - |
| ETT50_RS03285 (ETT50_03285) | - | 625922..626362 (+) | 441 | WP_032465112.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT50_RS03290 (ETT50_03290) | - | 626359..626715 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| ETT50_RS09650 (ETT50_03295) | - | 626712..626957 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| ETT50_RS03300 (ETT50_03300) | - | 626957..627169 (+) | 213 | WP_032465111.1 | DUF3310 domain-containing protein | - |
| ETT50_RS09400 | - | 627190..627360 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| ETT50_RS03305 (ETT50_03305) | - | 627357..627641 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| ETT50_RS03310 (ETT50_03310) | - | 627643..628275 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ETT50_RS03315 (ETT50_03315) | - | 628651..629085 (+) | 435 | WP_032461637.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT50_RS03340 (ETT50_03340) | - | 630018..630932 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| ETT50_RS09405 | - | 631022..631255 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| ETT50_RS03350 (ETT50_03350) | - | 631550..631927 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ETT50_RS03355 (ETT50_03355) | - | 631979..632164 (-) | 186 | WP_032465109.1 | type II toxin-antitoxin system HicA family toxin | - |
| ETT50_RS03365 (ETT50_03365) | - | 632400..632741 (+) | 342 | WP_029714359.1 | HNH endonuclease | - |
| ETT50_RS03370 (ETT50_03370) | - | 632910..633377 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ETT50_RS03375 (ETT50_03375) | - | 633392..635146 (+) | 1755 | WP_032465108.1 | terminase large subunit | - |
| ETT50_RS09410 | - | 635143..635313 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| ETT50_RS03380 (ETT50_03380) | - | 635306..635530 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| ETT50_RS03385 (ETT50_03385) | - | 635564..636784 (+) | 1221 | WP_032465107.1 | phage portal protein | - |
| ETT50_RS03390 (ETT50_03390) | - | 636762..637427 (+) | 666 | WP_032465106.1 | head maturation protease, ClpP-related | - |
| ETT50_RS03395 (ETT50_03395) | - | 637452..638636 (+) | 1185 | WP_021340812.1 | phage major capsid protein | - |
| ETT50_RS09520 | - | 638650..638778 (+) | 129 | WP_021340813.1 | hypothetical protein | - |
| ETT50_RS03400 (ETT50_03400) | - | 638781..639083 (+) | 303 | WP_021340811.1 | head-tail connector protein | - |
| ETT50_RS03405 (ETT50_03405) | - | 639080..639427 (+) | 348 | WP_003055344.1 | phage head closure protein | - |
| ETT50_RS03410 (ETT50_03410) | - | 639424..639801 (+) | 378 | WP_003055321.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT50_RS03415 (ETT50_03415) | - | 639798..640223 (+) | 426 | WP_011017584.1 | hypothetical protein | - |
| ETT50_RS03420 (ETT50_03420) | - | 640239..640847 (+) | 609 | WP_011017585.1 | major tail protein | - |
| ETT50_RS03425 (ETT50_03425) | gpG | 640900..641226 (+) | 327 | WP_011017586.1 | phage tail assembly chaperone G | - |
| ETT50_RS09415 | - | 641274..641423 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| ETT50_RS03430 (ETT50_03430) | - | 641436..645359 (+) | 3924 | WP_032465105.1 | phage tail tape measure protein | - |
| ETT50_RS03435 (ETT50_03435) | - | 645359..646066 (+) | 708 | WP_032465104.1 | distal tail protein Dit | - |
| ETT50_RS03440 (ETT50_03440) | - | 646063..648207 (+) | 2145 | WP_032465102.1 | phage tail spike protein | - |
| ETT50_RS03445 (ETT50_03445) | hylP | 648204..649229 (+) | 1026 | WP_032465101.1 | hyaluronidase HylP | - |
| ETT50_RS03450 (ETT50_03450) | - | 649242..651125 (+) | 1884 | WP_136118837.1 | gp58-like family protein | - |
| ETT50_RS03455 (ETT50_03455) | - | 651137..651568 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| ETT50_RS03460 (ETT50_03460) | - | 651571..652188 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| ETT50_RS03465 (ETT50_03465) | - | 652198..652473 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| ETT50_RS03470 (ETT50_03470) | - | 652470..652697 (+) | 228 | WP_000609113.1 | phage holin | - |
| ETT50_RS03475 (ETT50_03475) | - | 652813..654015 (+) | 1203 | WP_032465097.1 | glucosaminidase domain-containing protein | - |
| ETT50_RS09525 (ETT50_03480) | - | 654048..654230 (+) | 183 | Protein_612 | holin | - |
| ETT50_RS03485 (ETT50_03485) | - | 654382..654924 (+) | 543 | WP_032465096.1 | Panacea domain-containing protein | - |
| ETT50_RS03490 (ETT50_03490) | - | 654928..655764 (+) | 837 | WP_032465095.1 | hypothetical protein | - |
| ETT50_RS03495 (ETT50_03495) | spek | 656068..656847 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| ETT50_RS03500 (ETT50_03500) | - | 657323..657898 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| ETT50_RS03510 (ETT50_03510) | prx | 658244..658426 (+) | 183 | WP_032465094.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=342186 ETT50_RS03275 WP_011285575.1 625288..625713(+) (ssb) [Streptococcus pyogenes strain emm56]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=342186 ETT50_RS03275 WP_011285575.1 625288..625713(+) (ssb) [Streptococcus pyogenes strain emm56]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |