Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ETT58_RS05410 | Genome accession | NZ_CP035441 |
| Coordinates | 1034716..1035141 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999457..1045767 | 1034716..1035141 | within | 0 |
Gene organization within MGE regions
Location: 999457..1045767
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT58_RS05180 (ETT58_05175) | pfkA | 999457..1000470 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ETT58_RS05185 (ETT58_05180) | - | 1000550..1003660 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ETT58_RS05190 (ETT58_05185) | - | 1003845..1004216 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ETT58_RS05195 (ETT58_05190) | - | 1004216..1004914 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ETT58_RS05200 (ETT58_05195) | - | 1004924..1005709 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ETT58_RS05205 (ETT58_05200) | - | 1005836..1006450 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ETT58_RS05215 (ETT58_05210) | prx | 1007041..1007229 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ETT58_RS05220 (ETT58_05215) | speA | 1007449..1008204 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ETT58_RS05225 (ETT58_05220) | - | 1008326..1008985 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ETT58_RS05230 (ETT58_05225) | - | 1008985..1009206 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ETT58_RS05235 (ETT58_05230) | - | 1009216..1009989 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ETT58_RS05240 (ETT58_05235) | - | 1010000..1010602 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ETT58_RS05245 (ETT58_05240) | - | 1010614..1011378 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ETT58_RS05250 (ETT58_05245) | - | 1011380..1011712 (-) | 333 | WP_011285562.1 | phage holin | - |
| ETT58_RS05255 (ETT58_05250) | - | 1011712..1012035 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ETT58_RS09675 | - | 1012049..1012171 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ETT58_RS05260 (ETT58_05255) | - | 1012185..1012532 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ETT58_RS05265 (ETT58_05260) | - | 1012543..1014405 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ETT58_RS05270 (ETT58_05265) | - | 1014410..1017850 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ETT58_RS05275 (ETT58_05270) | - | 1017851..1019335 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ETT58_RS05280 (ETT58_05275) | - | 1019336..1021141 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ETT58_RS05285 (ETT58_05280) | - | 1021134..1021592 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ETT58_RS05290 (ETT58_05285) | - | 1021565..1021882 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ETT58_RS05295 (ETT58_05290) | - | 1021895..1022401 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ETT58_RS05300 (ETT58_05295) | - | 1022413..1022823 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ETT58_RS05305 (ETT58_05300) | - | 1022825..1023220 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ETT58_RS05310 (ETT58_05305) | - | 1023217..1023528 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ETT58_RS05315 (ETT58_05310) | - | 1023525..1023869 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ETT58_RS05320 (ETT58_05315) | - | 1023883..1024176 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ETT58_RS05325 (ETT58_05320) | - | 1024189..1025079 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ETT58_RS05330 (ETT58_05325) | - | 1025098..1025667 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ETT58_RS09680 | - | 1025776..1025910 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ETT58_RS05335 (ETT58_05330) | - | 1025912..1026181 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ETT58_RS05340 (ETT58_05335) | - | 1026188..1027096 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ETT58_RS05345 (ETT58_05340) | - | 1027065..1028390 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ETT58_RS05350 (ETT58_05345) | - | 1028390..1029664 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ETT58_RS05355 (ETT58_05350) | - | 1029654..1030034 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ETT58_RS05360 (ETT58_05355) | - | 1030644..1031078 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT58_RS05365 (ETT58_05360) | - | 1031364..1031630 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ETT58_RS05370 (ETT58_05365) | - | 1031627..1032151 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ETT58_RS05375 (ETT58_05370) | - | 1032154..1032786 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ETT58_RS05380 (ETT58_05375) | - | 1032788..1033072 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ETT58_RS09530 | - | 1033069..1033239 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ETT58_RS05385 (ETT58_05380) | - | 1033236..1033472 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ETT58_RS09760 (ETT58_05385) | - | 1033472..1033717 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ETT58_RS05395 (ETT58_05390) | - | 1033714..1034070 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ETT58_RS05400 (ETT58_05395) | - | 1034067..1034507 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT58_RS05405 (ETT58_05400) | - | 1034507..1034710 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ETT58_RS05410 (ETT58_05405) | ssb | 1034716..1035141 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT58_RS05415 (ETT58_05410) | - | 1035134..1035808 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ETT58_RS05420 (ETT58_05415) | - | 1035809..1036291 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ETT58_RS05425 (ETT58_05420) | - | 1036313..1036567 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ETT58_RS05430 (ETT58_05425) | - | 1036548..1036901 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ETT58_RS05435 (ETT58_05430) | - | 1037042..1037824 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ETT58_RS05440 (ETT58_05435) | - | 1037811..1038641 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ETT58_RS09685 (ETT58_05440) | - | 1038655..1038843 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| ETT58_RS09690 | - | 1039077..1039316 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ETT58_RS05455 (ETT58_05450) | - | 1039447..1039656 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ETT58_RS05460 (ETT58_05455) | - | 1039766..1039966 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ETT58_RS05465 (ETT58_05460) | - | 1040040..1040426 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ETT58_RS05470 (ETT58_05465) | - | 1040415..1040624 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ETT58_RS05475 (ETT58_05470) | - | 1040678..1041277 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ETT58_RS05480 (ETT58_05475) | - | 1041307..1041465 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ETT58_RS05485 (ETT58_05480) | - | 1041822..1042646 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ETT58_RS05490 (ETT58_05485) | - | 1042682..1043575 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ETT58_RS05495 (ETT58_05490) | - | 1043696..1044784 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ETT58_RS05500 (ETT58_05495) | - | 1045147..1045767 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=341752 ETT58_RS05410 WP_011285575.1 1034716..1035141(-) (ssb) [Streptococcus pyogenes strain emm1]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=341752 ETT58_RS05410 WP_011285575.1 1034716..1035141(-) (ssb) [Streptococcus pyogenes strain emm1]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |