Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EQH17_RS09750 | Genome accession | NZ_CP035263 |
| Coordinates | 1928673..1929089 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609561.1 | Uniprot ID | A0A237KAF1 |
| Organism | Streptococcus pneumoniae strain TVO_1901922 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1899825..1953960 | 1928673..1929089 | within | 0 |
Gene organization within MGE regions
Location: 1899825..1953960
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH17_RS09550 (EQH17_10110) | lytA | 1899825..1900781 (-) | 957 | WP_061632303.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| EQH17_RS09555 (EQH17_10115) | - | 1900785..1901117 (-) | 333 | WP_061632304.1 | phage holin | - |
| EQH17_RS09560 (EQH17_10120) | - | 1901121..1901537 (-) | 417 | WP_001165341.1 | phage holin family protein | - |
| EQH17_RS09565 (EQH17_10125) | - | 1901547..1901897 (-) | 351 | WP_000852244.1 | hypothetical protein | - |
| EQH17_RS09570 (EQH17_10130) | - | 1901900..1902103 (-) | 204 | WP_001091119.1 | hypothetical protein | - |
| EQH17_RS11115 (EQH17_10135) | - | 1902084..1902201 (-) | 118 | Protein_1884 | dihydrodipicolinate reductase | - |
| EQH17_RS09575 (EQH17_10140) | - | 1902198..1908581 (-) | 6384 | WP_061632305.1 | tail fiber domain-containing protein | - |
| EQH17_RS09580 (EQH17_10145) | - | 1908586..1908936 (-) | 351 | WP_000068031.1 | DUF6711 family protein | - |
| EQH17_RS09585 (EQH17_10150) | - | 1908945..1912598 (-) | 3654 | WP_061632306.1 | hypothetical protein | - |
| EQH17_RS09590 (EQH17_10155) | - | 1912585..1912935 (-) | 351 | WP_000478010.1 | hypothetical protein | - |
| EQH17_RS09595 (EQH17_10160) | - | 1912974..1913354 (-) | 381 | WP_001185635.1 | DUF6096 family protein | - |
| EQH17_RS09600 (EQH17_10165) | - | 1913359..1913772 (-) | 414 | WP_000880678.1 | phage tail tube protein | - |
| EQH17_RS09605 (EQH17_10170) | - | 1913775..1914143 (-) | 369 | WP_000608233.1 | hypothetical protein | - |
| EQH17_RS09610 (EQH17_10175) | - | 1914140..1914655 (-) | 516 | WP_000015941.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EQH17_RS09615 (EQH17_10180) | - | 1914630..1914968 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| EQH17_RS09620 (EQH17_10185) | - | 1914949..1915260 (-) | 312 | WP_000021219.1 | phage head-tail connector protein | - |
| EQH17_RS09625 (EQH17_10190) | - | 1915262..1915450 (-) | 189 | WP_000669350.1 | hypothetical protein | - |
| EQH17_RS09630 (EQH17_10195) | - | 1915440..1915622 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| EQH17_RS09635 (EQH17_10200) | - | 1915634..1916479 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| EQH17_RS09640 (EQH17_10205) | - | 1916486..1917070 (-) | 585 | WP_001288024.1 | DUF4355 domain-containing protein | - |
| EQH17_RS09645 (EQH17_10210) | - | 1917297..1917548 (-) | 252 | WP_000913247.1 | DUF6275 family protein | - |
| EQH17_RS09650 (EQH17_10215) | - | 1917550..1917795 (-) | 246 | WP_000877357.1 | hypothetical protein | - |
| EQH17_RS09655 (EQH17_10220) | - | 1917847..1918074 (-) | 228 | WP_050110656.1 | hypothetical protein | - |
| EQH17_RS09660 (EQH17_10225) | - | 1918062..1919465 (-) | 1404 | WP_225791266.1 | minor capsid protein | - |
| EQH17_RS09665 (EQH17_10230) | - | 1919374..1920843 (-) | 1470 | WP_079106950.1 | phage portal protein | - |
| EQH17_RS09670 (EQH17_10235) | - | 1920855..1922078 (-) | 1224 | WP_001864388.1 | PBSX family phage terminase large subunit | - |
| EQH17_RS09675 (EQH17_10240) | - | 1922068..1922526 (-) | 459 | WP_061632307.1 | hypothetical protein | - |
| EQH17_RS09680 (EQH17_10245) | - | 1922555..1923847 (-) | 1293 | WP_322349249.1 | DNA modification methylase | - |
| EQH17_RS09695 (EQH17_10255) | - | 1924414..1924836 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| EQH17_RS09700 (EQH17_10260) | - | 1924906..1925271 (-) | 366 | WP_000802874.1 | hypothetical protein | - |
| EQH17_RS09705 (EQH17_10265) | - | 1925268..1925588 (-) | 321 | WP_001268497.1 | hypothetical protein | - |
| EQH17_RS09710 (EQH17_10270) | - | 1925585..1925998 (-) | 414 | WP_061632309.1 | YopX family protein | - |
| EQH17_RS09715 (EQH17_10275) | - | 1925995..1926669 (-) | 675 | WP_061632310.1 | DUF1642 domain-containing protein | - |
| EQH17_RS09720 (EQH17_10280) | - | 1926671..1926988 (-) | 318 | WP_000969680.1 | hypothetical protein | - |
| EQH17_RS09725 (EQH17_10285) | - | 1927013..1927195 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| EQH17_RS09730 (EQH17_10290) | - | 1927211..1927642 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EQH17_RS09735 (EQH17_10295) | - | 1927639..1927968 (-) | 330 | WP_050105888.1 | hypothetical protein | - |
| EQH17_RS09740 (EQH17_10300) | - | 1927982..1928191 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| EQH17_RS09745 (EQH17_10305) | - | 1928157..1928663 (-) | 507 | WP_000034831.1 | class I SAM-dependent methyltransferase | - |
| EQH17_RS09750 (EQH17_10310) | ssbA | 1928673..1929089 (-) | 417 | WP_000609561.1 | single-stranded DNA-binding protein | Machinery gene |
| EQH17_RS09755 (EQH17_10315) | - | 1929184..1929519 (-) | 336 | WP_000598345.1 | sporulation protein Cse60 | - |
| EQH17_RS09760 (EQH17_10320) | - | 1929512..1929835 (-) | 324 | WP_000354630.1 | hypothetical protein | - |
| EQH17_RS09765 (EQH17_10325) | - | 1929813..1930877 (-) | 1065 | WP_061632311.1 | DUF1351 domain-containing protein | - |
| EQH17_RS09770 (EQH17_10330) | bet | 1930887..1931639 (-) | 753 | WP_050307441.1 | phage recombination protein Bet | - |
| EQH17_RS09775 (EQH17_10335) | - | 1931657..1931842 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| EQH17_RS09780 (EQH17_10340) | - | 1932096..1932356 (-) | 261 | WP_000471465.1 | hypothetical protein | - |
| EQH17_RS09785 (EQH17_10345) | - | 1932349..1932552 (-) | 204 | WP_061632312.1 | hypothetical protein | - |
| EQH17_RS09790 | - | 1932552..1932713 (-) | 162 | WP_179209669.1 | BOW99_gp33 family protein | - |
| EQH17_RS09795 | - | 1932778..1932921 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| EQH17_RS09800 (EQH17_10350) | - | 1933040..1933231 (+) | 192 | WP_000834564.1 | hypothetical protein | - |
| EQH17_RS09805 (EQH17_10360) | - | 1933403..1933570 (-) | 168 | WP_000152772.1 | hypothetical protein | - |
| EQH17_RS09810 (EQH17_10365) | - | 1933560..1934414 (-) | 855 | WP_001862954.1 | ATP-binding protein | - |
| EQH17_RS09815 (EQH17_10370) | - | 1934424..1935239 (-) | 816 | WP_050206911.1 | replication initiator protein A | - |
| EQH17_RS09820 (EQH17_10375) | - | 1935255..1935467 (-) | 213 | WP_050206913.1 | helix-turn-helix transcriptional regulator | - |
| EQH17_RS09825 (EQH17_10385) | - | 1935659..1935958 (-) | 300 | WP_180378152.1 | hypothetical protein | - |
| EQH17_RS09830 (EQH17_10390) | - | 1936033..1936308 (-) | 276 | WP_050206914.1 | hypothetical protein | - |
| EQH17_RS09835 (EQH17_10395) | - | 1936474..1937235 (+) | 762 | WP_050206915.1 | S24 family peptidase | - |
| EQH17_RS09840 (EQH17_10400) | - | 1937237..1938001 (+) | 765 | WP_050073181.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| EQH17_RS09845 (EQH17_10405) | - | 1938280..1939725 (+) | 1446 | WP_061632313.1 | recombinase family protein | - |
| EQH17_RS09850 (EQH17_10410) | - | 1939725..1939805 (-) | 81 | Protein_1938 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| EQH17_RS09855 (EQH17_10415) | comGB/cglB | 1939807..1940823 (-) | 1017 | WP_077141332.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| EQH17_RS09860 (EQH17_10420) | comGA/cglA/cilD | 1940771..1941712 (-) | 942 | WP_000249550.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| EQH17_RS09865 (EQH17_10425) | - | 1941788..1942153 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| EQH17_RS09870 (EQH17_10430) | - | 1942304..1943362 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| EQH17_RS09875 (EQH17_10435) | nagA | 1943525..1944676 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| EQH17_RS09880 (EQH17_10440) | - | 1944829..1946646 (-) | 1818 | WP_001220850.1 | acyltransferase family protein | - |
| EQH17_RS09885 (EQH17_10445) | tgt | 1946744..1947886 (-) | 1143 | WP_001285232.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| EQH17_RS09890 (EQH17_10450) | - | 1948016..1948873 (+) | 858 | WP_001108865.1 | DUF975 family protein | - |
| EQH17_RS09895 (EQH17_10460) | - | 1948900..1949518 (-) | 619 | Protein_1947 | pyroglutamyl-peptidase I | - |
| EQH17_RS09900 (EQH17_10465) | - | 1949625..1949993 (-) | 369 | WP_000022863.1 | DUF1304 domain-containing protein | - |
| EQH17_RS09905 (EQH17_10470) | - | 1950004..1950428 (-) | 425 | Protein_1949 | MarR family winged helix-turn-helix transcriptional regulator | - |
| EQH17_RS09910 (EQH17_10475) | - | 1950748..1951890 (-) | 1143 | WP_000746983.1 | LysM domain-containing protein | - |
| EQH17_RS09915 (EQH17_10480) | - | 1952056..1952676 (-) | 621 | WP_001172823.1 | HAD family hydrolase | - |
| EQH17_RS09920 (EQH17_10485) | - | 1952680..1953960 (-) | 1281 | WP_000473959.1 | MATE family efflux transporter | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15252.97 Da Isoelectric Point: 6.9800
>NTDB_id=338574 EQH17_RS09750 WP_000609561.1 1928673..1929089(-) (ssbA) [Streptococcus pneumoniae strain TVO_1901922]
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=338574 EQH17_RS09750 WP_000609561.1 1928673..1929089(-) (ssbA) [Streptococcus pneumoniae strain TVO_1901922]
ATGATAAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTCAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
ATGATAAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTCAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.429 |
100 |
0.551 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.86 |
100 |
0.543 |
| ssbA | Streptococcus mutans UA159 |
46.377 |
100 |
0.464 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.377 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
76.812 |
0.399 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
93.478 |
0.391 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.476 |
76.087 |
0.384 |