Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EQH22_RS08975 | Genome accession | NZ_CP035258 |
| Coordinates | 1774907..1775323 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609559.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901927 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1742563..1786087 | 1774907..1775323 | within | 0 |
Gene organization within MGE regions
Location: 1742563..1786087
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH22_RS08760 (EQH22_09225) | groL | 1742563..1744185 (-) | 1623 | WP_000031575.1 | chaperonin GroEL | - |
| EQH22_RS08765 (EQH22_09230) | groES | 1744201..1744485 (-) | 285 | WP_000917339.1 | co-chaperone GroES | - |
| EQH22_RS08770 (EQH22_09235) | ssbB/cilA | 1744755..1745132 (-) | 378 | WP_000580361.1 | single-stranded DNA-binding protein | Machinery gene |
| EQH22_RS08775 (EQH22_09240) | - | 1745159..1745401 (-) | 243 | WP_000698517.1 | hypothetical protein | - |
| EQH22_RS08780 (EQH22_09245) | lytA | 1745633..1746589 (-) | 957 | WP_000350534.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| EQH22_RS08785 (EQH22_09250) | - | 1746595..1746924 (-) | 330 | WP_001186214.1 | phage holin | - |
| EQH22_RS08790 (EQH22_09255) | - | 1746928..1747227 (-) | 300 | WP_001810279.1 | hypothetical protein | - |
| EQH22_RS08795 (EQH22_09260) | - | 1747237..1747587 (-) | 351 | WP_054393306.1 | hypothetical protein | - |
| EQH22_RS08800 (EQH22_09265) | - | 1747590..1747793 (-) | 204 | WP_001091112.1 | hypothetical protein | - |
| EQH22_RS11075 (EQH22_09270) | - | 1747774..1747890 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| EQH22_RS08805 (EQH22_09275) | - | 1747887..1753133 (-) | 5247 | WP_409202187.1 | tail fiber domain-containing protein | - |
| EQH22_RS08810 (EQH22_09285) | - | 1755289..1755639 (-) | 351 | WP_000068018.1 | DUF6711 family protein | - |
| EQH22_RS08815 (EQH22_09290) | - | 1755648..1759319 (-) | 3672 | WP_061754579.1 | hypothetical protein | - |
| EQH22_RS08820 (EQH22_09295) | - | 1759306..1759656 (-) | 351 | WP_000478007.1 | hypothetical protein | - |
| EQH22_RS08825 (EQH22_09300) | - | 1759695..1760075 (-) | 381 | WP_001185631.1 | DUF6096 family protein | - |
| EQH22_RS08830 (EQH22_09305) | - | 1760080..1760493 (-) | 414 | WP_000880665.1 | phage tail tube protein | - |
| EQH22_RS08835 (EQH22_09310) | - | 1760496..1760864 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| EQH22_RS08840 (EQH22_09315) | - | 1760861..1761376 (-) | 516 | WP_000015940.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EQH22_RS08845 (EQH22_09320) | - | 1761351..1761689 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| EQH22_RS08850 (EQH22_09325) | - | 1761670..1761981 (-) | 312 | WP_000021218.1 | phage head-tail connector protein | - |
| EQH22_RS08855 (EQH22_09330) | - | 1761983..1762171 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| EQH22_RS08860 (EQH22_09335) | - | 1762181..1763206 (-) | 1026 | WP_000863393.1 | carbohydrate-binding protein | - |
| EQH22_RS08865 (EQH22_09340) | - | 1763229..1763753 (-) | 525 | WP_001288022.1 | DUF4355 domain-containing protein | - |
| EQH22_RS08870 | - | 1764020..1764193 (-) | 174 | WP_000356388.1 | hypothetical protein | - |
| EQH22_RS08875 (EQH22_09345) | - | 1764235..1764648 (-) | 414 | WP_000565273.1 | HD domain-containing protein | - |
| EQH22_RS08880 (EQH22_09350) | - | 1764645..1764854 (-) | 210 | WP_000651746.1 | hypothetical protein | - |
| EQH22_RS08885 (EQH22_09355) | - | 1764856..1766493 (-) | 1638 | WP_164993540.1 | minor capsid protein | - |
| EQH22_RS08890 (EQH22_09360) | - | 1766402..1767871 (-) | 1470 | WP_000285392.1 | phage portal protein | - |
| EQH22_RS08895 (EQH22_09365) | - | 1767883..1769181 (-) | 1299 | WP_061640473.1 | PBSX family phage terminase large subunit | - |
| EQH22_RS08900 (EQH22_09370) | - | 1769159..1769599 (-) | 441 | WP_001841119.1 | terminase small subunit | - |
| EQH22_RS08910 (EQH22_09375) | - | 1770067..1770471 (-) | 405 | WP_001030241.1 | DUF1492 domain-containing protein | - |
| EQH22_RS08915 (EQH22_09380) | - | 1770544..1770915 (-) | 372 | WP_001247150.1 | hypothetical protein | - |
| EQH22_RS08920 (EQH22_09385) | - | 1770912..1771349 (-) | 438 | WP_000188937.1 | YopX family protein | - |
| EQH22_RS08925 (EQH22_09390) | - | 1771361..1771783 (-) | 423 | WP_000140868.1 | hypothetical protein | - |
| EQH22_RS08930 (EQH22_09395) | - | 1771780..1772040 (-) | 261 | WP_000819329.1 | DUF1372 family protein | - |
| EQH22_RS10925 | - | 1772037..1772159 (-) | 123 | WP_001842508.1 | hypothetical protein | - |
| EQH22_RS08935 (EQH22_09400) | - | 1772198..1772686 (-) | 489 | WP_001041151.1 | DUF1642 domain-containing protein | - |
| EQH22_RS08940 (EQH22_09405) | - | 1772688..1773005 (-) | 318 | WP_000969676.1 | hypothetical protein | - |
| EQH22_RS08945 (EQH22_09410) | - | 1773030..1773212 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| EQH22_RS08950 (EQH22_09415) | - | 1773228..1773659 (-) | 432 | WP_000779141.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EQH22_RS08955 (EQH22_09420) | - | 1773656..1773985 (-) | 330 | WP_000157070.1 | hypothetical protein | - |
| EQH22_RS08960 (EQH22_09425) | - | 1773999..1774208 (-) | 210 | WP_000455270.1 | hypothetical protein | - |
| EQH22_RS08965 | - | 1774210..1774521 (-) | 312 | WP_238115198.1 | site-specific DNA-methyltransferase | - |
| EQH22_RS08970 | - | 1774613..1774894 (-) | 282 | WP_225791293.1 | DNA methyltransferase | - |
| EQH22_RS08975 (EQH22_09435) | ssbA | 1774907..1775323 (-) | 417 | WP_000609559.1 | single-stranded DNA-binding protein | Machinery gene |
| EQH22_RS08980 (EQH22_09440) | - | 1775418..1775753 (-) | 336 | WP_000598345.1 | sporulation protein Cse60 | - |
| EQH22_RS08985 (EQH22_09445) | - | 1775746..1776069 (-) | 324 | WP_000354630.1 | hypothetical protein | - |
| EQH22_RS08990 (EQH22_09450) | - | 1776047..1777135 (-) | 1089 | WP_001157029.1 | DUF1351 domain-containing protein | - |
| EQH22_RS08995 (EQH22_09455) | bet | 1777145..1777963 (-) | 819 | WP_000184004.1 | phage recombination protein Bet | - |
| EQH22_RS09000 (EQH22_09460) | - | 1778233..1778493 (-) | 261 | WP_000471459.1 | hypothetical protein | - |
| EQH22_RS09005 (EQH22_09465) | - | 1778506..1778760 (-) | 255 | WP_000275523.1 | hypothetical protein | - |
| EQH22_RS09010 (EQH22_09470) | - | 1778761..1778982 (-) | 222 | WP_000771950.1 | hypothetical protein | - |
| EQH22_RS09015 | - | 1778982..1779119 (-) | 138 | WP_000869368.1 | hypothetical protein | - |
| EQH22_RS09020 (EQH22_09475) | - | 1779137..1779934 (-) | 798 | WP_001056933.1 | ParB N-terminal domain-containing protein | - |
| EQH22_RS09025 | - | 1780001..1780144 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| EQH22_RS09030 (EQH22_09480) | - | 1780263..1780454 (+) | 192 | WP_000834563.1 | hypothetical protein | - |
| EQH22_RS09035 (EQH22_09490) | - | 1780864..1781184 (-) | 321 | WP_223687705.1 | HTH domain-containing protein | - |
| EQH22_RS09040 (EQH22_09495) | - | 1781269..1781496 (-) | 228 | WP_001125554.1 | helix-turn-helix transcriptional regulator | - |
| EQH22_RS09045 (EQH22_09500) | - | 1781569..1781775 (+) | 207 | WP_000133214.1 | hypothetical protein | - |
| EQH22_RS09050 | - | 1782000..1782170 (-) | 171 | WP_000660185.1 | hypothetical protein | - |
| EQH22_RS09055 (EQH22_09510) | - | 1782369..1782818 (+) | 450 | WP_001058908.1 | hypothetical protein | - |
| EQH22_RS09060 | - | 1782809..1782976 (-) | 168 | WP_001005822.1 | hypothetical protein | - |
| EQH22_RS09065 (EQH22_09515) | - | 1783051..1783326 (-) | 276 | WP_001094375.1 | hypothetical protein | - |
| EQH22_RS09070 (EQH22_09520) | - | 1783499..1784290 (+) | 792 | WP_000090699.1 | XRE family transcriptional regulator | - |
| EQH22_RS09075 (EQH22_09525) | - | 1784292..1784492 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| EQH22_RS09080 (EQH22_09530) | - | 1784660..1786087 (+) | 1428 | WP_000859012.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15253.01 Da Isoelectric Point: 8.0002
>NTDB_id=338171 EQH22_RS08975 WP_000609559.1 1774907..1775323(-) (ssbA) [Streptococcus pneumoniae strain TVO_1901927]
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFKAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFKAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=338171 EQH22_RS08975 WP_000609559.1 1774907..1775323(-) (ssbA) [Streptococcus pneumoniae strain TVO_1901927]
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAACAATGTATCTAGCTT
GCAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTAAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAACAATGTATCTAGCTT
GCAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTAAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.429 |
100 |
0.551 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.86 |
100 |
0.543 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.377 |
100 |
0.464 |
| ssbA | Streptococcus mutans UA159 |
46.377 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
76.812 |
0.399 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
93.478 |
0.391 |