Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | EQH24_RS00065 | Genome accession | NZ_CP035256 |
| Coordinates | 14254..14733 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588897.1 | Uniprot ID | Q9R2W8 |
| Organism | Streptococcus pneumoniae strain TVO_1901930 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..93308 | 14254..14733 | within | 0 |
Gene organization within MGE regions
Location: 12174..93308
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH24_RS00060 (EQH24_00060) | ftsH | 12174..14132 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| EQH24_RS00065 (EQH24_00065) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| EQH24_RS00100 (EQH24_00100) | - | 20235..21016 (-) | 782 | Protein_14 | transposase | - |
| EQH24_RS00105 (EQH24_00105) | comW | 21282..21518 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| EQH24_RS00110 (EQH24_00110) | - | 21749..23035 (+) | 1287 | WP_023396065.1 | adenylosuccinate synthase | - |
| EQH24_RS00115 (EQH24_00115) | tadA | 23236..23703 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| EQH24_RS00125 (EQH24_00125) | - | 23912..25054 (-) | 1143 | WP_000266837.1 | site-specific integrase | - |
| EQH24_RS00130 (EQH24_00130) | - | 25173..25523 (-) | 351 | WP_001020945.1 | hypothetical protein | - |
| EQH24_RS00135 (EQH24_00135) | - | 25537..25917 (-) | 381 | WP_000136430.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EQH24_RS00140 (EQH24_00140) | - | 25939..26295 (-) | 357 | WP_000153672.1 | helix-turn-helix domain-containing protein | - |
| EQH24_RS00145 (EQH24_00145) | - | 26571..26756 (+) | 186 | WP_000638668.1 | helix-turn-helix transcriptional regulator | - |
| EQH24_RS00150 (EQH24_00150) | - | 26758..27456 (+) | 699 | WP_001004041.1 | phage antirepressor KilAC domain-containing protein | - |
| EQH24_RS00155 (EQH24_00155) | - | 27521..27787 (+) | 267 | WP_000046504.1 | hypothetical protein | - |
| EQH24_RS00160 (EQH24_00160) | - | 27961..28227 (+) | 267 | WP_024475376.1 | helix-turn-helix domain-containing protein | - |
| EQH24_RS00165 (EQH24_00165) | - | 28462..28728 (+) | 267 | WP_000450966.1 | hypothetical protein | - |
| EQH24_RS00170 (EQH24_00170) | - | 28811..29263 (+) | 453 | WP_001134285.1 | hypothetical protein | - |
| EQH24_RS00175 (EQH24_00175) | - | 29269..29970 (+) | 702 | WP_000774580.1 | ERF family protein | - |
| EQH24_RS00180 (EQH24_00180) | - | 29973..30965 (+) | 993 | WP_000237811.1 | DUF1351 domain-containing protein | - |
| EQH24_RS00185 | - | 30987..31163 (+) | 177 | WP_001203349.1 | hypothetical protein | - |
| EQH24_RS00190 (EQH24_00185) | ssbA | 31153..31728 (+) | 576 | WP_050250037.1 | single-stranded DNA-binding protein | Machinery gene |
| EQH24_RS00195 (EQH24_00190) | - | 31742..32026 (+) | 285 | WP_001865204.1 | hypothetical protein | - |
| EQH24_RS00200 (EQH24_00195) | - | 32040..33173 (+) | 1134 | WP_033605032.1 | DNA cytosine methyltransferase | - |
| EQH24_RS00205 (EQH24_00200) | - | 33217..33420 (+) | 204 | WP_000161128.1 | hypothetical protein | - |
| EQH24_RS00210 (EQH24_00205) | - | 33448..33627 (+) | 180 | Protein_35 | hypothetical protein | - |
| EQH24_RS00215 (EQH24_00210) | - | 33644..33856 (+) | 213 | WP_001286809.1 | crAss001_48 related protein | - |
| EQH24_RS00220 (EQH24_00215) | - | 33867..34268 (+) | 402 | WP_000667209.1 | hypothetical protein | - |
| EQH24_RS00225 (EQH24_00220) | - | 34270..34476 (+) | 207 | WP_000573750.1 | hypothetical protein | - |
| EQH24_RS00230 (EQH24_00225) | - | 34525..34842 (+) | 318 | WP_000969686.1 | hypothetical protein | - |
| EQH24_RS00235 (EQH24_00230) | - | 34928..35566 (+) | 639 | WP_224782728.1 | DUF1642 domain-containing protein | - |
| EQH24_RS00240 (EQH24_00235) | - | 35550..35837 (+) | 288 | WP_050217665.1 | hypothetical protein | - |
| EQH24_RS00245 (EQH24_00240) | - | 35837..36175 (+) | 339 | WP_238101670.1 | hypothetical protein | - |
| EQH24_RS00250 (EQH24_00245) | - | 36249..36623 (+) | 375 | WP_001814280.1 | YopX family protein | - |
| EQH24_RS00255 (EQH24_00250) | - | 36683..36925 (+) | 243 | WP_001067626.1 | DUF3310 domain-containing protein | - |
| EQH24_RS00260 (EQH24_00255) | - | 36922..37314 (+) | 393 | WP_000162611.1 | hypothetical protein | - |
| EQH24_RS00265 (EQH24_00260) | - | 37380..38474 (+) | 1095 | WP_137995635.1 | DUF4417 domain-containing protein | - |
| EQH24_RS00270 (EQH24_00265) | - | 38455..39201 (+) | 747 | WP_050228803.1 | hypothetical protein | - |
| EQH24_RS00275 (EQH24_00275) | - | 39405..39860 (+) | 456 | WP_001136857.1 | KGG domain-containing protein | - |
| EQH24_RS00280 (EQH24_00280) | - | 39850..41160 (+) | 1311 | WP_000143806.1 | PBSX family phage terminase large subunit | - |
| EQH24_RS00285 (EQH24_00285) | - | 41173..42741 (+) | 1569 | WP_050148261.1 | phage portal protein | - |
| EQH24_RS00290 | - | 42728..42901 (+) | 174 | WP_000169861.1 | hypothetical protein | - |
| EQH24_RS00295 (EQH24_00290) | - | 42944..44095 (+) | 1152 | WP_050236910.1 | phage minor capsid protein | - |
| EQH24_RS00300 (EQH24_00295) | - | 44234..44797 (+) | 564 | WP_000896122.1 | phage scaffolding protein | - |
| EQH24_RS00305 (EQH24_00300) | - | 44815..45696 (+) | 882 | WP_083967606.1 | phage capsid protein | - |
| EQH24_RS00310 (EQH24_00305) | - | 45707..45940 (+) | 234 | WP_001240346.1 | hypothetical protein | - |
| EQH24_RS00315 (EQH24_00310) | - | 45983..46384 (+) | 402 | WP_238101671.1 | hypothetical protein | - |
| EQH24_RS00320 (EQH24_00315) | - | 46374..46745 (+) | 372 | WP_000565932.1 | putative minor capsid protein | - |
| EQH24_RS00325 (EQH24_00320) | - | 46745..47089 (+) | 345 | WP_000020373.1 | minor capsid protein | - |
| EQH24_RS00330 (EQH24_00325) | - | 47089..47496 (+) | 408 | WP_001208881.1 | minor capsid protein | - |
| EQH24_RS00335 (EQH24_00330) | - | 47493..47942 (+) | 450 | WP_023396079.1 | phage tail tube protein | - |
| EQH24_RS00340 (EQH24_00335) | - | 48007..48495 (+) | 489 | WP_000129840.1 | hypothetical protein | - |
| EQH24_RS00345 (EQH24_00340) | - | 48508..49077 (+) | 570 | WP_155459897.1 | Gp15 family bacteriophage protein | - |
| EQH24_RS00350 (EQH24_00345) | - | 49070..52351 (+) | 3282 | WP_238101672.1 | tape measure protein | - |
| EQH24_RS00355 (EQH24_00350) | - | 52348..53862 (+) | 1515 | WP_000161549.1 | distal tail protein Dit | - |
| EQH24_RS00360 (EQH24_00355) | - | 53864..59176 (+) | 5313 | WP_238101673.1 | phage tail protein | - |
| EQH24_RS00365 (EQH24_00360) | - | 59187..61265 (+) | 2079 | WP_054377711.1 | DUF859 family phage minor structural protein | - |
| EQH24_RS00370 (EQH24_00365) | - | 61325..61588 (+) | 264 | WP_000922100.1 | hypothetical protein | - |
| EQH24_RS00375 (EQH24_00370) | - | 61598..62014 (+) | 417 | WP_000687457.1 | phage holin family protein | - |
| EQH24_RS00380 (EQH24_00375) | - | 62018..62350 (+) | 333 | WP_001186242.1 | phage holin | - |
| EQH24_RS00385 (EQH24_00380) | - | 62354..63310 (+) | 957 | WP_238101674.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| EQH24_RS00390 (EQH24_00385) | - | 63593..64036 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| EQH24_RS00395 (EQH24_00390) | - | 64038..64553 (+) | 516 | WP_001842035.1 | histidine phosphatase family protein | - |
| EQH24_RS00400 (EQH24_00395) | radA | 64567..65928 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| EQH24_RS00405 (EQH24_00400) | - | 66001..66498 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| EQH24_RS00410 (EQH24_00410) | - | 66523..67337 (+) | 815 | Protein_75 | PrsW family intramembrane metalloprotease | - |
| EQH24_RS00415 (EQH24_00415) | - | 67482..68450 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| EQH24_RS00420 (EQH24_00420) | - | 68584..68865 (-) | 282 | Protein_77 | ISL3 family transposase | - |
| EQH24_RS00425 | - | 68992..69899 (-) | 908 | Protein_78 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EQH24_RS00430 (EQH24_00440) | polA | 70155..72788 (+) | 2634 | WP_001842036.1 | DNA polymerase I | - |
| EQH24_RS00435 (EQH24_00445) | - | 72873..73310 (+) | 438 | WP_023396087.1 | CoA-binding protein | - |
| EQH24_RS00440 (EQH24_00450) | - | 73527..74537 (-) | 1011 | WP_023396088.1 | YeiH family protein | - |
| EQH24_RS00445 (EQH24_00455) | - | 75108..76277 (+) | 1170 | WP_023396089.1 | pyridoxal phosphate-dependent aminotransferase | - |
| EQH24_RS00450 (EQH24_00460) | recO | 76274..77044 (+) | 771 | WP_023396090.1 | DNA repair protein RecO | - |
| EQH24_RS00455 (EQH24_00465) | plsX | 77041..78033 (+) | 993 | WP_023396091.1 | phosphate acyltransferase PlsX | - |
| EQH24_RS00460 (EQH24_00470) | - | 78039..78272 (+) | 234 | WP_000136446.1 | acyl carrier protein | - |
| EQH24_RS00465 (EQH24_00475) | - | 78309..78608 (+) | 300 | Protein_86 | transposase family protein | - |
| EQH24_RS00470 (EQH24_00480) | - | 78811..78969 (+) | 159 | WP_001093073.1 | bacteriocin class II family protein | - |
| EQH24_RS11575 | - | 78972..79097 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| EQH24_RS00475 (EQH24_00485) | comA | 79688..81841 (+) | 2154 | WP_000668282.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| EQH24_RS00480 (EQH24_00490) | comB | 81854..83203 (+) | 1350 | WP_000801620.1 | competence pheromone export protein ComB | Regulator |
| EQH24_RS00485 (EQH24_00495) | purC | 83373..84080 (+) | 708 | WP_000043300.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| EQH24_RS11680 (EQH24_00500) | - | 84091..84213 (+) | 123 | WP_023396093.1 | hypothetical protein | - |
| EQH24_RS00490 (EQH24_00505) | - | 84282..88007 (+) | 3726 | WP_023396094.1 | phosphoribosylformylglycinamidine synthase | - |
| EQH24_RS00495 (EQH24_00510) | purF | 88100..89542 (+) | 1443 | WP_000220632.1 | amidophosphoribosyltransferase | - |
| EQH24_RS00500 (EQH24_00515) | purM | 89579..90601 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| EQH24_RS00505 (EQH24_00520) | purN | 90598..91143 (+) | 546 | WP_000717501.1 | phosphoribosylglycinamide formyltransferase | - |
| EQH24_RS00510 (EQH24_00525) | - | 91227..91736 (+) | 510 | WP_023396542.1 | VanZ family protein | - |
| EQH24_RS00515 (EQH24_00530) | purH | 91761..93308 (+) | 1548 | WP_000167081.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19873.52 Da Isoelectric Point: 7.3797
>NTDB_id=337963 EQH24_RS00065 WP_000588897.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain TVO_1901930]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=337963 EQH24_RS00065 WP_000588897.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain TVO_1901930]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.