Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SPJ_RS09350 | Genome accession | NC_012466 |
| Coordinates | 1773665..1774081 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609561.1 | Uniprot ID | A0A237KAF1 |
| Organism | Streptococcus pneumoniae JJA | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1742847..1784874 | 1773665..1774081 | within | 0 |
Gene organization within MGE regions
Location: 1742847..1784874
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPJ_RS09140 (SPJ_1840) | groL | 1742847..1744469 (-) | 1623 | WP_000031573.1 | chaperonin GroEL | - |
| SPJ_RS09145 (SPJ_1841) | groES | 1744485..1744769 (-) | 285 | WP_000917299.1 | co-chaperone GroES | - |
| SPJ_RS09150 (SPJ_1842) | ssbB/cilA | 1744925..1745305 (-) | 381 | WP_033621334.1 | single-stranded DNA-binding protein | Machinery gene |
| SPJ_RS09155 (SPJ_1843) | - | 1745329..1745571 (-) | 243 | WP_000698517.1 | hypothetical protein | - |
| SPJ_RS09160 (SPJ_1844) | lytA | 1745803..1746759 (-) | 957 | WP_000350534.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| SPJ_RS09165 (SPJ_1845) | - | 1746765..1747094 (-) | 330 | WP_001186214.1 | phage holin | - |
| SPJ_RS09170 (SPJ_1846) | - | 1747098..1747397 (-) | 300 | WP_001810279.1 | hypothetical protein | - |
| SPJ_RS09175 (SPJ_1847) | - | 1747407..1747757 (-) | 351 | WP_000852252.1 | hypothetical protein | - |
| SPJ_RS09180 (SPJ_1848) | - | 1747760..1747963 (-) | 204 | WP_001019662.1 | hypothetical protein | - |
| SPJ_RS12870 (SPJ_1849) | - | 1747944..1748060 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| SPJ_RS13435 (SPJ_1850) | - | 1748057..1754383 (-) | 6327 | WP_000339666.1 | tail fiber domain-containing protein | - |
| SPJ_RS09195 (SPJ_1851) | - | 1754388..1754738 (-) | 351 | WP_000068032.1 | DUF6711 family protein | - |
| SPJ_RS09200 (SPJ_1852) | - | 1754747..1758400 (-) | 3654 | WP_000212179.1 | hypothetical protein | - |
| SPJ_RS09205 (SPJ_1853) | - | 1758387..1758737 (-) | 351 | WP_000478015.1 | hypothetical protein | - |
| SPJ_RS09210 (SPJ_1854) | - | 1758776..1759156 (-) | 381 | WP_001185634.1 | DUF6096 family protein | - |
| SPJ_RS09215 (SPJ_1855) | - | 1759161..1759574 (-) | 414 | WP_000880674.1 | phage tail tube protein | - |
| SPJ_RS09220 (SPJ_1856) | - | 1759577..1759945 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| SPJ_RS09225 | - | 1759942..1760457 (-) | 516 | WP_000015942.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPJ_RS09230 (SPJ_1858) | - | 1760432..1760770 (-) | 339 | WP_000478945.1 | hypothetical protein | - |
| SPJ_RS09235 (SPJ_1859) | - | 1760751..1761062 (-) | 312 | WP_000021220.1 | phage head-tail connector protein | - |
| SPJ_RS09240 (SPJ_1860) | - | 1761064..1761252 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| SPJ_RS09245 (SPJ_1861) | - | 1761242..1761424 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| SPJ_RS09250 (SPJ_1862) | - | 1761436..1762281 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| SPJ_RS09255 (SPJ_1863) | - | 1762287..1762871 (-) | 585 | WP_001288021.1 | DUF4355 domain-containing protein | - |
| SPJ_RS09260 (SPJ_1864) | - | 1763088..1763339 (-) | 252 | WP_000890163.1 | DUF6275 family protein | - |
| SPJ_RS09265 (SPJ_1865) | - | 1763341..1763586 (-) | 246 | WP_000877357.1 | hypothetical protein | - |
| SPJ_RS09270 (SPJ_1866) | - | 1763629..1764042 (-) | 414 | WP_000565276.1 | HD domain-containing protein | - |
| SPJ_RS09275 (SPJ_1867) | - | 1764039..1764248 (-) | 210 | WP_000651747.1 | hypothetical protein | - |
| SPJ_RS09280 (SPJ_1868) | - | 1764250..1765887 (-) | 1638 | WP_174222386.1 | minor capsid protein | - |
| SPJ_RS09285 (SPJ_1869) | - | 1765796..1767265 (-) | 1470 | WP_000285401.1 | phage portal protein | - |
| SPJ_RS09290 (SPJ_1870) | - | 1767277..1768575 (-) | 1299 | WP_000084426.1 | PBSX family phage terminase large subunit | - |
| SPJ_RS09295 (SPJ_1871) | - | 1768553..1769053 (-) | 501 | WP_012677066.1 | terminase small subunit | - |
| SPJ_RS09300 (SPJ_1873) | - | 1769461..1769865 (-) | 405 | WP_001030241.1 | DUF1492 domain-containing protein | - |
| SPJ_RS09305 | - | 1769938..1770309 (-) | 372 | WP_001247150.1 | hypothetical protein | - |
| SPJ_RS09310 (SPJ_1874) | - | 1770306..1770743 (-) | 438 | WP_000188937.1 | YopX family protein | - |
| SPJ_RS09315 (SPJ_1875) | - | 1770755..1771177 (-) | 423 | WP_000140868.1 | hypothetical protein | - |
| SPJ_RS09320 | - | 1771174..1771434 (-) | 261 | WP_000819325.1 | DUF1372 family protein | - |
| SPJ_RS13605 (SPJ_1876) | - | 1771431..1771553 (-) | 123 | WP_001842508.1 | hypothetical protein | - |
| SPJ_RS09325 (SPJ_1877) | - | 1771592..1772284 (-) | 693 | WP_001041158.1 | DUF1642 domain-containing protein | - |
| SPJ_RS09330 (SPJ_1878) | - | 1772286..1772603 (-) | 318 | WP_000969674.1 | hypothetical protein | - |
| SPJ_RS09335 | - | 1772628..1772810 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| SPJ_RS09340 (SPJ_1879) | - | 1772826..1773257 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPJ_RS09345 (SPJ_1880) | - | 1773254..1773652 (-) | 399 | WP_000401829.1 | hypothetical protein | - |
| SPJ_RS09350 (SPJ_1881) | ssbA | 1773665..1774081 (-) | 417 | WP_000609561.1 | single-stranded DNA-binding protein | Machinery gene |
| SPJ_RS09355 | - | 1774176..1774511 (-) | 336 | WP_000598346.1 | sporulation protein Cse60 | - |
| SPJ_RS09360 (SPJ_1883) | - | 1774504..1774827 (-) | 324 | WP_029743260.1 | hypothetical protein | - |
| SPJ_RS09365 (SPJ_1884) | - | 1774995..1776059 (-) | 1065 | WP_001157032.1 | DUF1351 domain-containing protein | - |
| SPJ_RS09370 (SPJ_1885) | bet | 1776069..1776887 (-) | 819 | WP_000184003.1 | phage recombination protein Bet | - |
| SPJ_RS09375 (SPJ_1887) | - | 1777157..1777417 (-) | 261 | WP_000471459.1 | hypothetical protein | - |
| SPJ_RS09380 (SPJ_1888) | - | 1777430..1777684 (-) | 255 | WP_000275523.1 | hypothetical protein | - |
| SPJ_RS09385 (SPJ_1889) | - | 1777685..1777906 (-) | 222 | WP_000771950.1 | hypothetical protein | - |
| SPJ_RS13105 (SPJ_1890) | - | 1777906..1778043 (-) | 138 | WP_000869368.1 | hypothetical protein | - |
| SPJ_RS09390 (SPJ_1891) | - | 1778061..1778852 (-) | 792 | WP_224782006.1 | ParB N-terminal domain-containing protein | - |
| SPJ_RS13110 (SPJ_1892) | - | 1778925..1779068 (-) | 144 | WP_000389583.1 | hypothetical protein | - |
| SPJ_RS09395 (SPJ_1894) | - | 1779185..1779409 (+) | 225 | WP_000517704.1 | DUF2188 domain-containing protein | - |
| SPJ_RS09400 (SPJ_1893) | - | 1779406..1779588 (-) | 183 | WP_001247797.1 | hypothetical protein | - |
| SPJ_RS09405 (SPJ_1895) | - | 1779773..1780051 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| SPJ_RS09410 (SPJ_1896) | - | 1780218..1780454 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| SPJ_RS09415 | - | 1780646..1780936 (-) | 291 | WP_000167802.1 | hypothetical protein | - |
| SPJ_RS09420 (SPJ_1899) | - | 1781135..1781584 (+) | 450 | WP_001058908.1 | hypothetical protein | - |
| SPJ_RS13115 (SPJ_1898) | - | 1781575..1781742 (-) | 168 | WP_001005822.1 | hypothetical protein | - |
| SPJ_RS09425 (SPJ_1900) | - | 1781817..1782092 (-) | 276 | WP_001094380.1 | hypothetical protein | - |
| SPJ_RS09430 (SPJ_1901) | - | 1782253..1783005 (+) | 753 | WP_001023158.1 | S24 family peptidase | - |
| SPJ_RS09435 | - | 1783007..1783207 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| SPJ_RS09440 (SPJ_1903) | - | 1783389..1784816 (+) | 1428 | WP_000633503.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15252.97 Da Isoelectric Point: 6.9800
>NTDB_id=33172 SPJ_RS09350 WP_000609561.1 1773665..1774081(-) (ssbA) [Streptococcus pneumoniae JJA]
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=33172 SPJ_RS09350 WP_000609561.1 1773665..1774081(-) (ssbA) [Streptococcus pneumoniae JJA]
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTCCAAGCGT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTCCAAGCGT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.429 |
100 |
0.551 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.86 |
100 |
0.543 |
| ssbA | Streptococcus mutans UA159 |
46.377 |
100 |
0.464 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.377 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
76.812 |
0.399 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
93.478 |
0.391 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.476 |
76.087 |
0.384 |