Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | D2E16_RS03845 | Genome accession | NZ_CP032064 |
| Coordinates | 792278..792676 (+) | Length | 132 a.a. |
| NCBI ID | WP_044669145.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain YSJ17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 774804..830830 | 792278..792676 | within | 0 |
Gene organization within MGE regions
Location: 774804..830830
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2E16_RS03715 (D2E16_03830) | - | 774804..776828 (+) | 2025 | WP_192370112.1 | surface-anchored 5'-nucleotidase | - |
| D2E16_RS03720 (D2E16_03835) | - | 777232..778395 (-) | 1164 | WP_194472493.1 | IS30 family transposase | - |
| D2E16_RS03730 (D2E16_03845) | - | 778684..779778 (-) | 1095 | WP_172047127.1 | tyrosine-type recombinase/integrase | - |
| D2E16_RS03735 (D2E16_03850) | - | 779951..780718 (+) | 768 | WP_172047126.1 | hypothetical protein | - |
| D2E16_RS03740 (D2E16_03855) | - | 780710..781399 (-) | 690 | WP_192370086.1 | hypothetical protein | - |
| D2E16_RS03745 (D2E16_03865) | - | 781685..782482 (-) | 798 | WP_029997636.1 | DUF1828 domain-containing protein | - |
| D2E16_RS03750 (D2E16_03870) | - | 782487..782942 (-) | 456 | WP_029997638.1 | DUF6978 family protein | - |
| D2E16_RS03755 (D2E16_03875) | - | 782955..783704 (-) | 750 | WP_172038159.1 | XRE family transcriptional regulator | - |
| D2E16_RS12500 | - | 783945..784073 (+) | 129 | WP_004195146.1 | hypothetical protein | - |
| D2E16_RS03760 (D2E16_03880) | - | 784112..784348 (+) | 237 | WP_029187677.1 | hypothetical protein | - |
| D2E16_RS03765 (D2E16_03885) | - | 784341..785063 (-) | 723 | WP_172047230.1 | hypothetical protein | - |
| D2E16_RS03770 (D2E16_03890) | - | 785117..785839 (+) | 723 | WP_172047229.1 | phage antirepressor KilAC domain-containing protein | - |
| D2E16_RS03775 (D2E16_03895) | - | 785920..786174 (+) | 255 | WP_024379791.1 | hypothetical protein | - |
| D2E16_RS03780 (D2E16_03900) | - | 786219..786503 (+) | 285 | WP_172061537.1 | hypothetical protein | - |
| D2E16_RS03785 (D2E16_03905) | - | 786496..786726 (+) | 231 | WP_024379789.1 | hypothetical protein | - |
| D2E16_RS03790 (D2E16_03910) | - | 786719..786943 (+) | 225 | WP_044667234.1 | hypothetical protein | - |
| D2E16_RS03795 (D2E16_03915) | - | 786947..787543 (+) | 597 | WP_044667233.1 | HNH endonuclease signature motif containing protein | - |
| D2E16_RS03800 (D2E16_03920) | - | 787527..788009 (+) | 483 | WP_044667232.1 | siphovirus Gp157 family protein | - |
| D2E16_RS03805 (D2E16_03925) | - | 788006..788317 (+) | 312 | WP_225620827.1 | hypothetical protein | - |
| D2E16_RS03810 (D2E16_03930) | - | 788439..789611 (+) | 1173 | WP_172087454.1 | DEAD/DEAH box helicase family protein | - |
| D2E16_RS03815 | - | 790073..790240 (+) | 168 | WP_172029604.1 | hypothetical protein | - |
| D2E16_RS03820 (D2E16_03935) | - | 790240..790410 (+) | 171 | WP_172029605.1 | CopG family transcriptional regulator | - |
| D2E16_RS03825 (D2E16_03940) | - | 790587..790826 (+) | 240 | WP_023371163.1 | hypothetical protein | - |
| D2E16_RS03830 (D2E16_03945) | - | 790819..791277 (+) | 459 | WP_172029606.1 | hypothetical protein | - |
| D2E16_RS03835 (D2E16_03950) | - | 791287..791985 (+) | 699 | WP_172008602.1 | ERF family protein | - |
| D2E16_RS03840 (D2E16_03955) | - | 791985..792281 (+) | 297 | WP_172008601.1 | hypothetical protein | - |
| D2E16_RS03845 (D2E16_03960) | ssbA | 792278..792676 (+) | 399 | WP_044669145.1 | single-stranded DNA-binding protein | Machinery gene |
| D2E16_RS03850 (D2E16_03965) | - | 792687..793514 (+) | 828 | WP_044689605.1 | bifunctional DNA primase/polymerase | - |
| D2E16_RS03855 (D2E16_03970) | - | 793498..794877 (+) | 1380 | WP_079396020.1 | virulence-associated E family protein | - |
| D2E16_RS03860 | - | 795256..795411 (+) | 156 | WP_171992161.1 | hypothetical protein | - |
| D2E16_RS03865 (D2E16_03975) | - | 795438..795713 (+) | 276 | WP_044689630.1 | DUF1372 family protein | - |
| D2E16_RS03870 (D2E16_03980) | - | 795710..796276 (+) | 567 | WP_192370233.1 | DUF1642 domain-containing protein | - |
| D2E16_RS03875 (D2E16_03985) | - | 796289..796666 (+) | 378 | WP_029175848.1 | hypothetical protein | - |
| D2E16_RS03880 (D2E16_03990) | - | 796794..797186 (+) | 393 | WP_192370066.1 | YopX family protein | - |
| D2E16_RS03885 (D2E16_03995) | - | 797179..797394 (+) | 216 | WP_192370063.1 | hypothetical protein | - |
| D2E16_RS03890 (D2E16_04000) | - | 797481..798323 (+) | 843 | WP_192370061.1 | prohibitin family protein | - |
| D2E16_RS03895 (D2E16_04005) | - | 798398..798859 (+) | 462 | WP_044689607.1 | DUF1492 domain-containing protein | - |
| D2E16_RS03910 (D2E16_04015) | - | 799281..799724 (+) | 444 | WP_230334493.1 | terminase small subunit | - |
| D2E16_RS03915 (D2E16_04020) | - | 799711..801009 (+) | 1299 | WP_192370059.1 | PBSX family phage terminase large subunit | - |
| D2E16_RS03920 (D2E16_04025) | - | 801020..802507 (+) | 1488 | WP_192370056.1 | phage portal protein | - |
| D2E16_RS03925 (D2E16_04030) | - | 802500..804140 (+) | 1641 | WP_192370054.1 | phage minor capsid protein | - |
| D2E16_RS03930 (D2E16_04035) | - | 804137..804412 (+) | 276 | WP_024390514.1 | hypothetical protein | - |
| D2E16_RS03935 (D2E16_04040) | - | 804468..804716 (+) | 249 | WP_044775245.1 | hypothetical protein | - |
| D2E16_RS03940 (D2E16_04045) | - | 804879..805481 (+) | 603 | WP_024379765.1 | hypothetical protein | - |
| D2E16_RS03945 (D2E16_04050) | - | 805483..806295 (+) | 813 | WP_172005196.1 | N4-gp56 family major capsid protein | - |
| D2E16_RS03950 (D2E16_04055) | - | 806311..806502 (+) | 192 | WP_104929713.1 | hypothetical protein | - |
| D2E16_RS03955 (D2E16_04060) | - | 806526..806918 (+) | 393 | WP_044683111.1 | hypothetical protein | - |
| D2E16_RS03960 (D2E16_04065) | - | 806920..807261 (+) | 342 | WP_104929715.1 | putative minor capsid protein | - |
| D2E16_RS03965 (D2E16_04070) | - | 807261..807605 (+) | 345 | WP_105159469.1 | minor capsid protein | - |
| D2E16_RS03970 (D2E16_04075) | - | 807605..808000 (+) | 396 | WP_044773187.1 | minor capsid protein | - |
| D2E16_RS03975 (D2E16_04080) | - | 808005..808460 (+) | 456 | WP_044677545.1 | phage tail tube protein | - |
| D2E16_RS03980 (D2E16_04085) | - | 808505..808957 (+) | 453 | WP_099872341.1 | hypothetical protein | - |
| D2E16_RS03985 (D2E16_04090) | - | 808966..809547 (+) | 582 | WP_105115199.1 | Gp15 family bacteriophage protein | - |
| D2E16_RS03990 (D2E16_04095) | - | 809537..812938 (+) | 3402 | WP_192370052.1 | tape measure protein | - |
| D2E16_RS03995 (D2E16_04100) | - | 812938..814434 (+) | 1497 | WP_192370050.1 | distal tail protein Dit | - |
| D2E16_RS04000 (D2E16_04105) | - | 814435..817065 (+) | 2631 | WP_194472495.1 | hypothetical protein | - |
| D2E16_RS04005 (D2E16_04110) | - | 817085..819142 (+) | 2058 | WP_192370219.1 | DUF859 family phage minor structural protein | - |
| D2E16_RS04010 (D2E16_04115) | - | 819155..819589 (+) | 435 | WP_192370218.1 | DUF1366 domain-containing protein | - |
| D2E16_RS04015 | - | 819612..819767 (+) | 156 | WP_153309144.1 | hypothetical protein | - |
| D2E16_RS04020 (D2E16_04120) | - | 819771..820049 (+) | 279 | WP_194472448.1 | hypothetical protein | - |
| D2E16_RS04025 (D2E16_04125) | - | 820055..820297 (+) | 243 | WP_024390532.1 | phage holin | - |
| D2E16_RS04030 (D2E16_04130) | - | 820385..821782 (+) | 1398 | WP_029177039.1 | peptidoglycan amidohydrolase family protein | - |
| D2E16_RS04035 | - | 822036..822311 (+) | 276 | WP_194472521.1 | hypothetical protein | - |
| D2E16_RS04040 (D2E16_04135) | - | 822491..823705 (-) | 1215 | WP_192369770.1 | chloride channel protein | - |
| D2E16_RS04045 (D2E16_04140) | - | 823695..823973 (-) | 279 | WP_044690963.1 | chorismate mutase | - |
| D2E16_RS04050 (D2E16_04145) | rpsN | 824055..824324 (-) | 270 | WP_002940393.1 | 30S ribosomal protein S14 | - |
| D2E16_RS04055 (D2E16_04150) | - | 824463..824924 (-) | 462 | WP_029178137.1 | flavodoxin | - |
| D2E16_RS04060 (D2E16_04155) | - | 825019..825963 (+) | 945 | WP_192369772.1 | DHH family phosphoesterase | - |
| D2E16_RS04065 (D2E16_04160) | - | 825980..826977 (+) | 998 | Protein_755 | FAD:protein FMN transferase | - |
| D2E16_RS04070 (D2E16_04165) | - | 827098..827340 (+) | 243 | WP_029177151.1 | type B 50S ribosomal protein L31 | - |
| D2E16_RS04075 (D2E16_04170) | - | 827442..828584 (-) | 1143 | WP_192369776.1 | site-specific integrase | - |
| D2E16_RS04080 (D2E16_04175) | - | 829601..830830 (+) | 1230 | WP_099776834.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14876.46 Da Isoelectric Point: 4.6582
>NTDB_id=313525 D2E16_RS03845 WP_044669145.1 792278..792676(+) (ssbA) [Streptococcus suis strain YSJ17]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGITGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGITGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=313525 D2E16_RS03845 WP_044669145.1 792278..792676(+) (ssbA) [Streptococcus suis strain YSJ17]
ATGATTAACAATGTAGTACTAGTGGGTCGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCCTTGCTGTCAATCGAAACTTCAAAAACCAAGATGGGGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCCGAAAACTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGAATTACAGGTCGCATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTTTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAATGTAGTACTAGTGGGTCGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCCTTGCTGTCAATCGAAACTTCAAAAACCAAGATGGGGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCCGAAAACTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGAATTACAGGTCGCATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTTTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.682 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.667 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.455 |
100 |
0.455 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.046 |
82.576 |
0.455 |
| ssbA | Streptococcus mutans UA159 |
44.697 |
100 |
0.447 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.386 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.226 |
80.303 |
0.371 |