Detailed information
Bioinformatically predicted
Overview
| Name | comEC | Type | Machinery gene |
| Locus tag | D0S48_RS21085 | Genome accession | NZ_CP031739 |
| Coordinates | 843320..843454 (-) | Length | 44 a.a. |
| NCBI ID | WP_255475382.1 | Uniprot ID | - |
| Organism | Psychrobacillus sp. AK 1817 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 838320..848454
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0S48_RS04360 (D0S48_04360) | - | 839116..840249 (-) | 1134 | WP_151110283.1 | site-specific integrase | - |
| D0S48_RS21280 (D0S48_04365) | - | 840426..840554 (-) | 129 | Protein_888 | DUF1998 domain-containing protein | - |
| D0S48_RS04370 (D0S48_04375) | - | 841575..842000 (-) | 426 | WP_151110285.1 | ABC transporter ATP-binding protein | - |
| D0S48_RS04375 (D0S48_04380) | - | 841993..842280 (-) | 288 | WP_151110287.1 | hypothetical protein | - |
| D0S48_RS04380 (D0S48_04385) | - | 842421..842774 (-) | 354 | WP_151110289.1 | hypothetical protein | - |
| D0S48_RS04385 (D0S48_04390) | - | 842798..842959 (-) | 162 | Protein_892 | polymorphic toxin type 50 domain-containing protein | - |
| D0S48_RS04395 (D0S48_04395) | - | 843100..843333 (-) | 234 | WP_151110292.1 | T7SS effector LXG polymorphic toxin | - |
| D0S48_RS21085 | comEC | 843320..843454 (-) | 135 | WP_255475382.1 | hypothetical protein | Machinery gene |
| D0S48_RS04400 (D0S48_04400) | cdiI | 843938..844321 (-) | 384 | WP_151110294.1 | ribonuclease toxin immunity protein CdiI | - |
| D0S48_RS04405 (D0S48_04405) | - | 844342..846195 (-) | 1854 | WP_151110296.1 | T7SS effector LXG polymorphic toxin | - |
| D0S48_RS04410 (D0S48_04410) | - | 846707..847618 (+) | 912 | WP_151110298.1 | helix-turn-helix domain-containing protein | - |
| D0S48_RS20540 | - | 848197..848352 (-) | 156 | WP_191963868.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 44 a.a. Molecular weight: 4731.10 Da Isoelectric Point: 4.2408
>NTDB_id=310958 D0S48_RS21085 WP_255475382.1 843320..843454(-) (comEC) [Psychrobacillus sp. AK 1817]
MADAGSNIEEYLLDKFDDISADVLKAGHHGSNTSSSAEFVNAFR
MADAGSNIEEYLLDKFDDISADVLKAGHHGSNTSSSAEFVNAFR
Nucleotide
Download Length: 135 bp
>NTDB_id=310958 D0S48_RS21085 WP_255475382.1 843320..843454(-) (comEC) [Psychrobacillus sp. AK 1817]
ATGGCTGATGCTGGCTCAAATATAGAAGAGTATTTATTGGACAAGTTTGATGATATTTCAGCAGACGTATTAAAGGCAGG
TCACCACGGATCTAATACAAGTAGTTCAGCTGAGTTTGTTAATGCATTTAGATGA
ATGGCTGATGCTGGCTCAAATATAGAAGAGTATTTATTGGACAAGTTTGATGATATTTCAGCAGACGTATTAAAGGCAGG
TCACCACGGATCTAATACAAGTAGTTCAGCTGAGTTTGTTAATGCATTTAGATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEC | Staphylococcus aureus MW2 |
50 |
100 |
0.5 |
| comEC | Staphylococcus aureus N315 |
50 |
100 |
0.5 |
| comA/comEC | Acinetobacter baylyi ADP1 |
46.512 |
97.727 |
0.455 |
| comA | Neisseria gonorrhoeae MS11 |
47.619 |
95.455 |
0.455 |
| comEC | Lactococcus lactis subsp. cremoris KW2 |
56.25 |
72.727 |
0.409 |
| comA/comEC | Acinetobacter baumannii D1279779 |
40.909 |
100 |
0.409 |
| comA/comEC | Acinetobacter baumannii strain A118 |
40.909 |
100 |
0.409 |
| comA | Pseudomonas stutzeri DSM 10701 |
43.902 |
93.182 |
0.409 |
| comEC/celB | Streptococcus mitis NCTC 12261 |
47.222 |
81.818 |
0.386 |
| comEC | Bacillus subtilis subsp. subtilis str. 168 |
44.444 |
81.818 |
0.364 |
| comEC/celB | Streptococcus mitis SK321 |
44.444 |
81.818 |
0.364 |