Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DZU27_RS03220 | Genome accession | NZ_CP031625 |
| Coordinates | 615370..615789 (+) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain MGAS28533 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 607073..648584 | 615370..615789 | within | 0 |
Gene organization within MGE regions
Location: 607073..648584
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZU27_RS03130 (DZU27_03130) | - | 607073..608170 (-) | 1098 | WP_015967409.1 | tyrosine-type recombinase/integrase | - |
| DZU27_RS03135 (DZU27_03135) | - | 608346..608867 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| DZU27_RS03140 (DZU27_03140) | - | 608878..609258 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZU27_RS03145 (DZU27_03145) | - | 609272..609631 (-) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| DZU27_RS03150 (DZU27_03150) | - | 610427..610618 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| DZU27_RS03155 (DZU27_03155) | - | 610629..611357 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| DZU27_RS09725 | - | 611390..611539 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| DZU27_RS03160 (DZU27_03160) | - | 611536..611736 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DZU27_RS03165 (DZU27_03165) | - | 611812..611979 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| DZU27_RS03175 (DZU27_03175) | - | 612225..612482 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| DZU27_RS03180 (DZU27_03180) | - | 612511..612696 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| DZU27_RS03185 (DZU27_03185) | - | 612790..613047 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| DZU27_RS03190 (DZU27_03190) | - | 613169..613582 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| DZU27_RS03195 (DZU27_03195) | - | 613563..613796 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| DZU27_RS03200 (DZU27_03200) | - | 613793..613933 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| DZU27_RS03205 (DZU27_03205) | - | 613944..614198 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| DZU27_RS03210 (DZU27_03210) | - | 614220..614702 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DZU27_RS03215 (DZU27_03215) | - | 614703..615377 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| DZU27_RS03220 (DZU27_03220) | ssbA | 615370..615789 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| DZU27_RS03225 (DZU27_03225) | - | 615795..615998 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DZU27_RS03230 (DZU27_03230) | - | 615998..616438 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DZU27_RS03235 (DZU27_03235) | - | 616435..616791 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| DZU27_RS03240 (DZU27_03240) | - | 616788..617039 (+) | 252 | WP_032461848.1 | hypothetical protein | - |
| DZU27_RS03245 (DZU27_03245) | - | 617033..617317 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DZU27_RS03250 (DZU27_03250) | - | 617314..617583 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| DZU27_RS03255 (DZU27_03255) | - | 617593..617997 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| DZU27_RS09730 | - | 617994..618164 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| DZU27_RS03260 (DZU27_03260) | - | 618161..618667 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DZU27_RS09735 | - | 618664..618834 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| DZU27_RS03265 (DZU27_03265) | - | 619108..619548 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZU27_RS03285 (DZU27_03285) | - | 620187..620444 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| DZU27_RS03290 (DZU27_03290) | - | 620525..621043 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| DZU27_RS03295 (DZU27_03295) | - | 621022..621699 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| DZU27_RS09845 (DZU27_03300) | - | 621708..622091 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| DZU27_RS03305 (DZU27_03305) | - | 622152..622529 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DZU27_RS03310 (DZU27_03310) | - | 622571..623053 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| DZU27_RS03315 (DZU27_03315) | - | 623136..624347 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DZU27_RS03320 (DZU27_03320) | - | 624361..625863 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| DZU27_RS03325 (DZU27_03325) | - | 625868..627346 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DZU27_RS03330 (DZU27_03330) | - | 627318..627557 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DZU27_RS03335 (DZU27_03335) | - | 627619..627885 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DZU27_RS03340 (DZU27_03340) | - | 628011..628625 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| DZU27_RS03345 (DZU27_03345) | - | 628629..629447 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DZU27_RS03350 (DZU27_03350) | - | 629501..629917 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| DZU27_RS03355 (DZU27_03355) | - | 629907..630239 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| DZU27_RS03360 (DZU27_03360) | - | 630239..630595 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DZU27_RS03365 (DZU27_03365) | - | 630592..630990 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DZU27_RS03370 (DZU27_03370) | - | 630990..631475 (+) | 486 | WP_011054741.1 | hypothetical protein | - |
| DZU27_RS03375 (DZU27_03375) | - | 631514..631948 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| DZU27_RS03380 (DZU27_03380) | - | 631952..632533 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| DZU27_RS03385 (DZU27_03385) | - | 632523..635783 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| DZU27_RS03390 (DZU27_03390) | - | 635780..636496 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| DZU27_RS03395 (DZU27_03395) | - | 636493..638637 (+) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| DZU27_RS03400 (DZU27_03400) | hylP | 638634..639647 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| DZU27_RS03405 (DZU27_03405) | - | 639662..641545 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| DZU27_RS03410 (DZU27_03410) | - | 641557..641988 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DZU27_RS03415 (DZU27_03415) | - | 641991..642602 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| DZU27_RS03420 (DZU27_03420) | - | 642613..642909 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| DZU27_RS03425 (DZU27_03425) | - | 642906..643091 (+) | 186 | WP_011054731.1 | holin | - |
| DZU27_RS03430 (DZU27_03430) | - | 643202..644404 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| DZU27_RS03435 (DZU27_03435) | - | 644544..645068 (+) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| DZU27_RS03440 (DZU27_03440) | - | 645056..645922 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| DZU27_RS03445 (DZU27_03445) | spek | 646226..647005 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DZU27_RS03450 (DZU27_03450) | - | 647481..648056 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| DZU27_RS09900 (DZU27_03455) | - | 648050..648337 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| DZU27_RS03460 (DZU27_03460) | prx | 648402..648584 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=308417 DZU27_RS03220 WP_011054759.1 615370..615789(+) (ssbA) [Streptococcus pyogenes strain MGAS28533]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=308417 DZU27_RS03220 WP_011054759.1 615370..615789(+) (ssbA) [Streptococcus pyogenes strain MGAS28533]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |