Detailed information NTG0307441

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: DV947_RS08725
• Genome accession: NZ_CP031545
• Coordinates: 1650283..1650609 (-)
• Length: 108 a.a.
• NCBI ID: WP_014727724.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain ST109
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1645283..1655609

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV947_RS10380 (DV947_08690)	-	1645550..1645975 (-)	426	WP_116920366.1	CPBP family intramembrane glutamic endopeptidase	-
DV947_RS08690 (DV947_08695)	-	1646218..1646415 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
DV947_RS08695 (DV947_08700)	-	1646664..1647857 (-)	1194	WP_014608740.1	acetate kinase	-
DV947_RS08700 (DV947_08705)	comYH	1647913..1648869 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
DV947_RS08705 (DV947_08710)	comGG	1648914..1649231 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
DV947_RS08710 (DV947_08715)	comYF	1649209..1649646 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
DV947_RS08715 (DV947_08720)	comGE	1649630..1649923 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
DV947_RS08720 (DV947_08725)	comYD	1649895..1650323 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
DV947_RS08725 (DV947_08730)	comYC	1650283..1650609 (-)	327	WP_014727724.1	competence type IV pilus major pilin ComGC	Machinery gene
DV947_RS08730 (DV947_08735)	comYB	1650606..1651706 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
DV947_RS08735 (DV947_08740)	comGA/cglA/cilD	1651588..1652529 (-)	942	WP_014727726.1	competence type IV pilus ATPase ComGA	Machinery gene
DV947_RS08740 (DV947_08745)	-	1652610..1652972 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11998.11 Da
• Isoelectric Point: 9.6951

>NTDB_id=307441 DV947_RS08725 WP_014727724.1 1650283..1650609(-) (comYC) [Streptococcus thermophilus strain ST109]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLEALVL
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=307441 DV947_RS08725 WP_014727724.1 1650283..1650609(-) (comYC) [Streptococcus thermophilus strain ST109]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGAAGCTCTTGTTTTA
GAAGGTCAAATTACTCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	55.66	98.148	0.546
comYC	Streptococcus suis isolate S10	59.091	81.481	0.481
comGC	Staphylococcus aureus MW2	51.282	72.222	0.37
comGC	Staphylococcus aureus N315	51.282	72.222	0.37