Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | DV129_RS08010 | Genome accession | NZ_CP031247 |
| Coordinates | 1472271..1472750 (-) | Length | 159 a.a. |
| NCBI ID | WP_000588897.1 | Uniprot ID | Q9R2W8 |
| Organism | Streptococcus pneumoniae strain M23734 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1413576..1474830 | 1472271..1472750 | within | 0 |
Gene organization within MGE regions
Location: 1413576..1474830
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DV129_RS07590 | recO | 1413576..1414346 (-) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
| DV129_RS07595 | - | 1414343..1415512 (-) | 1170 | WP_000366352.1 | pyridoxal phosphate-dependent aminotransferase | - |
| DV129_RS07600 | - | 1415661..1416671 (+) | 1011 | WP_000009173.1 | YeiH family protein | - |
| DV129_RS12320 | - | 1416700..1416993 (-) | 294 | WP_012677093.1 | hypothetical protein | - |
| DV129_RS07610 | - | 1417034..1417471 (-) | 438 | WP_000076480.1 | CoA-binding protein | - |
| DV129_RS07615 | polA | 1417556..1420189 (-) | 2634 | WP_001844860.1 | DNA polymerase I | - |
| DV129_RS12325 | - | 1420445..1421352 (+) | 908 | Protein_1441 | Rpn family recombination-promoting nuclease/putative transposase | - |
| DV129_RS07635 | - | 1421479..1421760 (+) | 282 | Protein_1442 | transposase family protein | - |
| DV129_RS07640 | - | 1421894..1422862 (-) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| DV129_RS07645 | - | 1423007..1423806 (-) | 800 | Protein_1444 | PrsW family intramembrane metalloprotease | - |
| DV129_RS07655 | - | 1423831..1424328 (-) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| DV129_RS07660 | radA | 1424401..1425762 (-) | 1362 | WP_078065389.1 | DNA repair protein RadA | Machinery gene |
| DV129_RS07665 | - | 1425776..1426291 (-) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| DV129_RS07670 | - | 1426293..1426736 (-) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| DV129_RS07680 | tadA | 1426923..1427390 (-) | 468 | WP_000291875.1 | tRNA adenosine(34) deaminase TadA | - |
| DV129_RS11755 | - | 1427672..1427821 (+) | 150 | WP_001030863.1 | hypothetical protein | - |
| DV129_RS07685 | - | 1427963..1428142 (+) | 180 | WP_001209433.1 | hypothetical protein | - |
| DV129_RS07690 | - | 1428412..1429368 (-) | 957 | WP_000350458.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| DV129_RS07695 | - | 1429368..1429703 (-) | 336 | WP_001186237.1 | phage holin | - |
| DV129_RS07700 | - | 1429707..1430123 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| DV129_RS07705 | - | 1430133..1430485 (-) | 353 | Protein_1455 | hypothetical protein | - |
| DV129_RS07710 | - | 1430488..1430691 (-) | 204 | WP_001091109.1 | hypothetical protein | - |
| DV129_RS12330 | - | 1430672..1430788 (-) | 117 | WP_001063632.1 | hypothetical protein | - |
| DV129_RS12335 | - | 1430785..1431396 (-) | 612 | WP_001846937.1 | tail fiber domain-containing protein | - |
| DV129_RS12340 | - | 1431356..1434004 (-) | 2649 | WP_012677074.1 | hypothetical protein | - |
| DV129_RS07730 | - | 1434050..1437271 (-) | 3222 | WP_001846667.1 | phage tail spike protein | - |
| DV129_RS07735 | - | 1437272..1437994 (-) | 723 | WP_000589852.1 | hypothetical protein | - |
| DV129_RS07740 | - | 1437991..1440750 (-) | 2760 | WP_000918322.1 | hypothetical protein | - |
| DV129_RS07745 | - | 1441028..1441447 (-) | 420 | WP_001227145.1 | hypothetical protein | - |
| DV129_RS07750 | - | 1441459..1442037 (-) | 579 | WP_000191278.1 | major tail protein | - |
| DV129_RS07755 | - | 1442049..1442372 (-) | 324 | WP_000777003.1 | hypothetical protein | - |
| DV129_RS07760 | - | 1442369..1442716 (-) | 348 | WP_000063886.1 | HK97 gp10 family phage protein | - |
| DV129_RS07765 | - | 1442713..1443012 (-) | 300 | WP_000267061.1 | phage head closure protein | - |
| DV129_RS07770 | - | 1442999..1443280 (-) | 282 | WP_000371962.1 | phage head-tail connector protein | - |
| DV129_RS07775 | - | 1443283..1443573 (-) | 291 | WP_000120767.1 | hypothetical protein | - |
| DV129_RS07780 | - | 1443585..1444757 (-) | 1173 | WP_001037663.1 | phage major capsid protein | - |
| DV129_RS07785 | - | 1444754..1445329 (-) | 576 | WP_001172113.1 | HK97 family phage prohead protease | - |
| DV129_RS07790 | - | 1445313..1446515 (-) | 1203 | WP_114865984.1 | phage portal protein | - |
| DV129_RS07795 | - | 1446533..1446751 (-) | 219 | WP_001002923.1 | hypothetical protein | - |
| DV129_RS07800 | - | 1446759..1448489 (-) | 1731 | WP_000527303.1 | terminase large subunit | - |
| DV129_RS07805 | - | 1448482..1448874 (-) | 393 | WP_001118282.1 | P27 family phage terminase small subunit | - |
| DV129_RS07810 | - | 1449012..1449332 (-) | 321 | WP_000282422.1 | HNH endonuclease | - |
| DV129_RS07815 | - | 1449452..1449643 (-) | 192 | WP_000238198.1 | hypothetical protein | - |
| DV129_RS07820 | - | 1449807..1450349 (-) | 543 | WP_000397552.1 | site-specific integrase | - |
| DV129_RS07825 | - | 1450538..1450939 (-) | 402 | WP_000736391.1 | transcriptional activator | - |
| DV129_RS11760 | - | 1451151..1451309 (-) | 159 | WP_153231720.1 | hypothetical protein | - |
| DV129_RS07830 | - | 1451306..1451542 (-) | 237 | WP_001067627.1 | DUF3310 domain-containing protein | - |
| DV129_RS07835 | - | 1451542..1451931 (-) | 390 | WP_000612387.1 | YopX family protein | - |
| DV129_RS07840 | - | 1451928..1452442 (-) | 515 | Protein_1483 | class I SAM-dependent methyltransferase | - |
| DV129_RS07845 | - | 1452442..1452867 (-) | 426 | WP_000772905.1 | DUF1642 domain-containing protein | - |
| DV129_RS07850 | - | 1452857..1453186 (-) | 330 | WP_000969678.1 | hypothetical protein | - |
| DV129_RS11970 | - | 1453354..1453521 (-) | 168 | WP_000233203.1 | hypothetical protein | - |
| DV129_RS07865 | - | 1453648..1453875 (-) | 228 | WP_000891963.1 | hypothetical protein | - |
| DV129_RS07870 | - | 1453875..1454069 (-) | 195 | WP_000470303.1 | hypothetical protein | - |
| DV129_RS07875 | - | 1454084..1454854 (-) | 771 | WP_000228214.1 | ATP-binding protein | - |
| DV129_RS07880 | - | 1454994..1455821 (-) | 828 | WP_001289767.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DV129_RS07885 | - | 1455814..1456110 (-) | 297 | WP_001156934.1 | hypothetical protein | - |
| DV129_RS07890 | - | 1456126..1456446 (-) | 321 | WP_000462827.1 | hypothetical protein | - |
| DV129_RS07895 | - | 1456532..1456789 (-) | 258 | WP_000370958.1 | hypothetical protein | - |
| DV129_RS07900 | - | 1456802..1457515 (-) | 714 | WP_001002346.1 | ORF6C domain-containing protein | - |
| DV129_RS07905 | - | 1457569..1457994 (+) | 426 | WP_000456433.1 | hypothetical protein | - |
| DV129_RS11975 | - | 1457989..1458150 (-) | 162 | WP_001004503.1 | hypothetical protein | - |
| DV129_RS07910 | - | 1458161..1458358 (-) | 198 | WP_001057654.1 | hypothetical protein | - |
| DV129_RS07915 | - | 1458375..1458578 (-) | 204 | WP_000032100.1 | hypothetical protein | - |
| DV129_RS07920 | - | 1458571..1458945 (-) | 375 | WP_000573356.1 | hypothetical protein | - |
| DV129_RS11980 | - | 1458989..1459135 (-) | 147 | WP_001001334.1 | hypothetical protein | - |
| DV129_RS07925 | - | 1459420..1459788 (+) | 369 | WP_000495824.1 | helix-turn-helix transcriptional regulator | - |
| DV129_RS07930 | - | 1459788..1460021 (+) | 234 | WP_000156422.1 | hypothetical protein | - |
| DV129_RS07935 | - | 1460021..1460284 (+) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DV129_RS07940 | - | 1460297..1460677 (+) | 381 | Protein_1504 | ImmA/IrrE family metallo-endopeptidase | - |
| DV129_RS07945 | - | 1460715..1461527 (+) | 813 | WP_001174227.1 | HIRAN domain-containing protein | - |
| DV129_RS07950 | - | 1461702..1462850 (+) | 1149 | WP_000876726.1 | site-specific integrase | - |
| DV129_RS07955 | - | 1463082..1464368 (-) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| DV129_RS07960 | comW | 1464599..1464835 (-) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| DV129_RS07965 | - | 1465100..1465897 (+) | 798 | Protein_1509 | transposase | - |
| DV129_RS07970 | - | 1465932..1466778 (-) | 847 | Protein_1510 | IS630 family transposase | - |
| DV129_RS08010 | comX/comX2 | 1472271..1472750 (-) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| DV129_RS08015 | ftsH | 1472872..1474830 (-) | 1959 | WP_000744537.1 | ATP-dependent zinc metalloprotease FtsH | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19873.52 Da Isoelectric Point: 7.3797
>NTDB_id=304775 DV129_RS08010 WP_000588897.1 1472271..1472750(-) (comX/comX2) [Streptococcus pneumoniae strain M23734]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=304775 DV129_RS08010 WP_000588897.1 1472271..1472750(-) (comX/comX2) [Streptococcus pneumoniae strain M23734]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.