Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | DV119_RS03060 | Genome accession | NZ_CP031245 |
| Coordinates | 546255..546734 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588874.1 | Uniprot ID | A0AA44S6A3 |
| Organism | Streptococcus pneumoniae strain M16808 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 542761..621320 | 546255..546734 | within | 0 |
| IS/Tn | 544784..546031 | 546255..546734 | flank | 224 |
Gene organization within MGE regions
Location: 542761..621320
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DV119_RS03050 | ftsH | 542761..544719 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| DV119_RS03055 | - | 544784..546031 (-) | 1248 | WP_114880800.1 | ISL3 family transposase | - |
| DV119_RS03060 | comX/comX2 | 546255..546734 (+) | 480 | WP_000588874.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| DV119_RS03095 | - | 552161..552958 (-) | 798 | Protein_534 | transposase | - |
| DV119_RS03100 | comW | 553224..553460 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| DV119_RS03105 | - | 553691..554977 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| DV119_RS03110 | - | 555219..556367 (-) | 1149 | WP_000876732.1 | tyrosine-type recombinase/integrase | - |
| DV119_RS03120 | - | 556553..557476 (-) | 924 | WP_000122591.1 | exonuclease domain-containing protein | - |
| DV119_RS03125 | - | 557489..557872 (-) | 384 | WP_001865140.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DV119_RS03130 | - | 557885..558250 (-) | 366 | WP_000492031.1 | helix-turn-helix domain-containing protein | - |
| DV119_RS03135 | - | 558556..559038 (-) | 483 | WP_000842471.1 | hypothetical protein | - |
| DV119_RS03140 | - | 559093..559296 (+) | 204 | WP_000032096.1 | hypothetical protein | - |
| DV119_RS03145 | - | 559313..559510 (+) | 198 | WP_001057654.1 | hypothetical protein | - |
| DV119_RS03150 | - | 559626..560285 (-) | 660 | WP_001865135.1 | hypothetical protein | - |
| DV119_RS03155 | - | 560339..561055 (+) | 717 | WP_001865134.1 | ORF6C domain-containing protein | - |
| DV119_RS03160 | - | 561068..561325 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| DV119_RS03165 | - | 561411..561731 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| DV119_RS03170 | - | 561747..562043 (+) | 297 | WP_001865133.1 | hypothetical protein | - |
| DV119_RS03175 | - | 562036..562842 (+) | 807 | WP_054387342.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DV119_RS03180 | - | 562982..563752 (+) | 771 | WP_000228214.1 | ATP-binding protein | - |
| DV119_RS12075 | - | 563767..563961 (+) | 195 | WP_000470305.1 | hypothetical protein | - |
| DV119_RS03190 | - | 563961..564188 (+) | 228 | WP_050267377.1 | hypothetical protein | - |
| DV119_RS11460 | - | 564315..564482 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| DV119_RS03205 | - | 564810..565163 (+) | 354 | WP_001177094.1 | helix-turn-helix domain-containing protein | - |
| DV119_RS03210 | - | 565145..565609 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| DV119_RS03215 | - | 565718..566260 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| DV119_RS03220 | - | 566801..567007 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| DV119_RS03225 | - | 567144..567638 (+) | 495 | WP_054387340.1 | hypothetical protein | - |
| DV119_RS03230 | - | 567631..569343 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| DV119_RS03235 | - | 569352..570494 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| DV119_RS03240 | - | 570541..571083 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| DV119_RS03245 | - | 571098..572351 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| DV119_RS03250 | - | 572377..572712 (+) | 336 | WP_000154006.1 | phage head-tail connector protein | - |
| DV119_RS03255 | - | 572709..573014 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| DV119_RS03260 | - | 573014..573361 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| DV119_RS03265 | - | 573348..573692 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| DV119_RS03270 | - | 573706..574374 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| DV119_RS03275 | - | 574376..574852 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| DV119_RS03285 | - | 575039..577777 (+) | 2739 | WP_000852167.1 | phage tail tape measure protein | - |
| DV119_RS03290 | - | 577774..578496 (+) | 723 | WP_050199190.1 | phage tail protein | - |
| DV119_RS03295 | - | 578497..586458 (+) | 7962 | WP_114880801.1 | phage tail spike protein | - |
| DV119_RS12080 | - | 586455..586571 (+) | 117 | WP_001063633.1 | hypothetical protein | - |
| DV119_RS03305 | - | 586552..586755 (+) | 204 | WP_001091109.1 | hypothetical protein | - |
| DV119_RS03310 | - | 586758..587108 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| DV119_RS03315 | - | 587118..587534 (+) | 417 | WP_001165341.1 | phage holin family protein | - |
| DV119_RS03320 | - | 587538..587870 (+) | 333 | WP_001186207.1 | phage holin | - |
| DV119_RS03325 | lytA | 587874..588830 (+) | 957 | WP_000350489.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| DV119_RS03330 | - | 589099..589278 (-) | 180 | WP_001233269.1 | hypothetical protein | - |
| DV119_RS11275 | - | 589420..589569 (-) | 150 | WP_162489709.1 | hypothetical protein | - |
| DV119_RS03335 | tadA | 589839..590306 (+) | 468 | WP_000291874.1 | tRNA adenosine(34) deaminase TadA | - |
| DV119_RS03345 | - | 590493..590936 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| DV119_RS03350 | - | 590938..591453 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| DV119_RS03355 | radA | 591467..592828 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| DV119_RS03360 | - | 592901..593398 (+) | 498 | WP_001809263.1 | beta-class carbonic anhydrase | - |
| DV119_RS03370 | - | 593423..594237 (+) | 815 | Protein_585 | PrsW family intramembrane metalloprotease | - |
| DV119_RS03375 | - | 594382..595350 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| DV119_RS11730 | - | 595468..596413 (+) | 946 | Protein_587 | Rpn family recombination-promoting nuclease/putative transposase | - |
| DV119_RS03395 | polA | 596916..599549 (+) | 2634 | WP_050279195.1 | DNA polymerase I | - |
| DV119_RS03400 | - | 599634..600071 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| DV119_RS11735 | - | 600112..600450 (+) | 339 | WP_061849647.1 | hypothetical protein | - |
| DV119_RS03405 | - | 600479..601489 (-) | 1011 | WP_000009175.1 | YeiH family protein | - |
| DV119_RS03410 | - | 601638..602807 (+) | 1170 | WP_000366348.1 | pyridoxal phosphate-dependent aminotransferase | - |
| DV119_RS03415 | recO | 602804..603574 (+) | 771 | WP_050220959.1 | DNA repair protein RecO | - |
| DV119_RS03420 | plsX | 603571..604563 (+) | 993 | WP_000717456.1 | phosphate acyltransferase PlsX | - |
| DV119_RS03425 | - | 604569..604802 (+) | 234 | WP_000136447.1 | acyl carrier protein | - |
| DV119_RS03430 | - | 604839..605138 (+) | 300 | Protein_596 | transposase family protein | - |
| DV119_RS03435 | blpU | 605341..605571 (+) | 231 | WP_001093487.1 | bacteriocin-like peptide BlpU | - |
| DV119_RS12005 | - | 605574..605699 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| DV119_RS03440 | - | 605949..607266 (-) | 1318 | Protein_599 | ISL3 family transposase | - |
| DV119_RS03445 | comA | 607700..609853 (+) | 2154 | WP_050221223.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| DV119_RS03450 | comB | 609866..611215 (+) | 1350 | WP_000801629.1 | competence pheromone export protein ComB | Regulator |
| DV119_RS03455 | purC | 611385..612092 (+) | 708 | WP_000043313.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| DV119_RS12085 | - | 612103..612237 (+) | 135 | WP_000429436.1 | hypothetical protein | - |
| DV119_RS03465 | - | 612294..616019 (+) | 3726 | WP_114880802.1 | phosphoribosylformylglycinamidine synthase | - |
| DV119_RS03470 | purF | 616112..617554 (+) | 1443 | WP_050104961.1 | amidophosphoribosyltransferase | - |
| DV119_RS03475 | purM | 617591..618613 (+) | 1023 | WP_114880803.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| DV119_RS03480 | purN | 618610..619155 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| DV119_RS03485 | - | 619239..619748 (+) | 510 | WP_050104960.1 | VanZ family protein | - |
| DV119_RS03490 | purH | 619773..621320 (+) | 1548 | WP_114880804.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19845.50 Da Isoelectric Point: 7.3795
>NTDB_id=304628 DV119_RS03060 WP_000588874.1 546255..546734(+) (comX/comX2) [Streptococcus pneumoniae strain M16808]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=304628 DV119_RS03060 WP_000588874.1 546255..546734(+) (comX/comX2) [Streptococcus pneumoniae strain M16808]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.