Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | D2E16_RS00865 | Genome accession | NZ_CP032064 |
| Coordinates | 144472..144753 (+) | Length | 93 a.a. |
| NCBI ID | WP_044765768.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain YSJ17 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 139472..149753
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2E16_RS00840 (D2E16_00870) | - | 140763..140969 (-) | 207 | WP_002941576.1 | hypothetical protein | - |
| D2E16_RS00845 (D2E16_00875) | tnpB | 141021..141371 (-) | 351 | WP_002941575.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| D2E16_RS00850 (D2E16_00880) | - | 141622..142485 (-) | 864 | Protein_133 | S66 family peptidase | - |
| D2E16_RS00855 (D2E16_00885) | comGA | 142571..143521 (+) | 951 | WP_100664710.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| D2E16_RS00860 (D2E16_00890) | comGB | 143433..144470 (+) | 1038 | WP_225620794.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| D2E16_RS00865 (D2E16_00895) | comGC | 144472..144753 (+) | 282 | WP_044765768.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| D2E16_RS00870 (D2E16_00900) | comGD | 144734..145141 (+) | 408 | WP_029173989.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| D2E16_RS00875 (D2E16_00905) | comGE | 145113..145406 (+) | 294 | WP_192369520.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| D2E16_RS00880 (D2E16_00910) | comGF/cglF | 145393..145827 (+) | 435 | WP_044765773.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| D2E16_RS00885 (D2E16_00915) | comGG | 145805..146332 (+) | 528 | WP_192369521.1 | competence type IV pilus minor pilin ComGG | - |
| D2E16_RS00890 (D2E16_00920) | comGH | 146388..147341 (+) | 954 | WP_192369522.1 | class I SAM-dependent methyltransferase | Machinery gene |
| D2E16_RS00895 (D2E16_00925) | - | 147392..148579 (+) | 1188 | WP_192369523.1 | acetate kinase | - |
| D2E16_RS00900 (D2E16_00930) | - | 148839..149390 (+) | 552 | WP_099806699.1 | folate family ECF transporter S component | - |
Sequence
Protein
Download Length: 93 a.a. Molecular weight: 10473.53 Da Isoelectric Point: 9.9102
>NTDB_id=274146 D2E16_RS00865 WP_044765768.1 144472..144753(+) (comGC) [Streptococcus suis strain YSJ17]
MKKLLKLKKKAFTLVEMLVVLGIISLLLLIFVPNLSKQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK
MKKLLKLKKKAFTLVEMLVVLGIISLLLLIFVPNLSKQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK
Nucleotide
Download Length: 282 bp
>NTDB_id=274146 D2E16_RS00865 WP_044765768.1 144472..144753(+) (comGC) [Streptococcus suis strain YSJ17]
ATGAAAAAATTGTTGAAATTAAAAAAGAAAGCTTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGTCTGCT
CTTGCTCATTTTTGTGCCTAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCTACGGTAGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA
ATGAAAAAATTGTTGAAATTAAAAAAGAAAGCTTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGTCTGCT
CTTGCTCATTTTTGTGCCTAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCTACGGTAGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Streptococcus suis isolate S10 |
86.022 |
100 |
0.86 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
64.13 |
98.925 |
0.634 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
64.13 |
98.925 |
0.634 |
| comGC/cglC | Streptococcus pneumoniae D39 |
64.13 |
98.925 |
0.634 |
| comGC/cglC | Streptococcus pneumoniae R6 |
64.13 |
98.925 |
0.634 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
64.13 |
98.925 |
0.634 |
| comGC/cglC | Streptococcus mitis SK321 |
64.13 |
98.925 |
0.634 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
64.045 |
95.699 |
0.613 |
| comGC | Streptococcus mutans UA140 |
59.091 |
94.624 |
0.559 |
| comGC | Streptococcus mutans UA159 |
59.091 |
94.624 |
0.559 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.818 |
94.624 |
0.538 |
| comGC | Staphylococcus aureus MW2 |
51.765 |
91.398 |
0.473 |
| comGC | Staphylococcus aureus N315 |
51.765 |
91.398 |
0.473 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
49.333 |
80.645 |
0.398 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
42.5 |
86.022 |
0.366 |