Detailed information NTG0274147

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: D2E16_RS00870
• Genome accession: NZ_CP032064
• Coordinates: 144734..145141 (+)
• Length: 135 a.a.
• NCBI ID: WP_029173989.1
• Uniprot ID: -
• Organism: Streptococcus suis strain YSJ17
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 139734..150141

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D2E16_RS00840 (D2E16_00870)	-	140763..140969 (-)	207	WP_002941576.1	hypothetical protein	-
D2E16_RS00845 (D2E16_00875)	tnpB	141021..141371 (-)	351	WP_002941575.1	IS66 family insertion sequence element accessory protein TnpB	-
D2E16_RS00850 (D2E16_00880)	-	141622..142485 (-)	864	Protein_133	S66 family peptidase	-
D2E16_RS00855 (D2E16_00885)	comGA	142571..143521 (+)	951	WP_100664710.1	competence type IV pilus ATPase ComGA	Machinery gene
D2E16_RS00860 (D2E16_00890)	comGB	143433..144470 (+)	1038	WP_225620794.1	competence type IV pilus assembly protein ComGB	Machinery gene
D2E16_RS00865 (D2E16_00895)	comGC	144472..144753 (+)	282	WP_044765768.1	competence type IV pilus major pilin ComGC	Machinery gene
D2E16_RS00870 (D2E16_00900)	comGD	144734..145141 (+)	408	WP_029173989.1	competence type IV pilus minor pilin ComGD	Machinery gene
D2E16_RS00875 (D2E16_00905)	comGE	145113..145406 (+)	294	WP_192369520.1	competence type IV pilus minor pilin ComGE	Machinery gene
D2E16_RS00880 (D2E16_00910)	comGF/cglF	145393..145827 (+)	435	WP_044765773.1	competence type IV pilus minor pilin ComGF	Machinery gene
D2E16_RS00885 (D2E16_00915)	comGG	145805..146332 (+)	528	WP_192369521.1	competence type IV pilus minor pilin ComGG	-
D2E16_RS00890 (D2E16_00920)	comGH	146388..147341 (+)	954	WP_192369522.1	class I SAM-dependent methyltransferase	Machinery gene
D2E16_RS00895 (D2E16_00925)	-	147392..148579 (+)	1188	WP_192369523.1	acetate kinase	-
D2E16_RS00900 (D2E16_00930)	-	148839..149390 (+)	552	WP_099806699.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 135 a.a.
• Molecular weight: 15315.52 Da
• Isoelectric Point: 9.6398

>NTDB_id=274147 D2E16_RS00870 WP_029173989.1 144734..145141(+) (comGD) [Streptococcus suis strain YSJ17]
MLRRKNKAFTLFESLLTLLVVSFLAISLSGTVQTVFRSVQEEIFLWEFEAIYKDSQKLAASSHQKVNLAIGGQEVTNGYQ
AVEVPGNVEVLEEKNIKFEENGGNSSLSKIRFRLSRKTVTYQLYIGSGRYKKTEE

Nucleotide

• Length: 408 bp

>NTDB_id=274147 D2E16_RS00870 WP_029173989.1 144734..145141(+) (comGD) [Streptococcus suis strain YSJ17]
ATGCTAAGGCGAAAAAATAAGGCTTTTACCCTATTTGAAAGCCTGCTGACCTTGTTGGTTGTCAGTTTTCTGGCAATCAG
CCTGTCGGGAACAGTACAAACGGTCTTTCGGTCTGTTCAGGAAGAAATTTTTCTCTGGGAATTTGAGGCCATCTATAAAG
ACAGTCAGAAATTGGCAGCCAGTTCCCATCAAAAAGTGAACCTTGCTATCGGTGGACAGGAGGTTACAAATGGTTATCAG
GCTGTAGAGGTACCCGGAAATGTAGAGGTCTTAGAGGAGAAAAATATCAAATTTGAAGAAAATGGAGGAAACTCCTCACT
GTCTAAAATTCGTTTTCGGCTTAGTCGAAAGACAGTTACGTATCAATTATATATAGGGAGTGGTCGCTATAAGAAAACAG
AAGAATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus gordonii str. Challis substr. CH1	48.819	94.074	0.459
comGD	Streptococcus mutans UA159	46.512	95.556	0.444
comGD	Streptococcus mutans UA140	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae Rx1	45.736	95.556	0.437
comGD/cglD	Streptococcus pneumoniae R6	45.736	95.556	0.437
comGD/cglD	Streptococcus pneumoniae D39	45.736	95.556	0.437
comGD/cglD	Streptococcus pneumoniae TIGR4	45.736	95.556	0.437
comGD/cglD	Streptococcus mitis SK321	44.961	95.556	0.43
comGD/cglD	Streptococcus mitis NCTC 12261	44.961	95.556	0.43
comGD	Lactococcus lactis subsp. cremoris KW2	40.625	94.815	0.385