Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CR542_RS02415 | Genome accession | NZ_CP024126 |
| Coordinates | 445526..445924 (+) | Length | 132 a.a. |
| NCBI ID | WP_022540565.1 | Uniprot ID | A0A0K2E4A3 |
| Organism | Streptococcus suis strain HA0609 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 437089..460109 | 445526..445924 | within | 0 |
Gene organization within MGE regions
Location: 437089..460109
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CR542_RS02335 (CR542_02330) | - | 437089..438246 (-) | 1158 | WP_024409220.1 | tyrosine-type recombinase/integrase | - |
| CR542_RS02340 (CR542_02335) | - | 438443..439174 (-) | 732 | WP_013730164.1 | hypothetical protein | - |
| CR542_RS02345 (CR542_02340) | - | 439222..439605 (-) | 384 | WP_013730165.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CR542_RS02350 (CR542_02345) | - | 439612..440160 (-) | 549 | WP_226960627.1 | helix-turn-helix domain-containing protein | - |
| CR542_RS02355 (CR542_02350) | - | 440177..440377 (+) | 201 | WP_002937001.1 | helix-turn-helix domain-containing protein | - |
| CR542_RS02360 (CR542_02355) | - | 440447..440773 (+) | 327 | WP_013730166.1 | hypothetical protein | - |
| CR542_RS02365 (CR542_02360) | - | 440847..441101 (+) | 255 | WP_013730167.1 | hypothetical protein | - |
| CR542_RS02370 (CR542_02365) | - | 441157..441390 (+) | 234 | WP_226960628.1 | hypothetical protein | - |
| CR542_RS11550 | - | 441380..441532 (+) | 153 | WP_022540561.1 | hypothetical protein | - |
| CR542_RS02375 (CR542_02370) | - | 441537..441878 (+) | 342 | WP_013730169.1 | hypothetical protein | - |
| CR542_RS02380 (CR542_02375) | - | 441878..442357 (+) | 480 | WP_013730170.1 | siphovirus Gp157 family protein | - |
| CR542_RS02385 (CR542_02380) | - | 442354..442599 (+) | 246 | WP_013730171.1 | hypothetical protein | - |
| CR542_RS02390 (CR542_02385) | - | 442580..443044 (+) | 465 | WP_013730172.1 | hypothetical protein | - |
| CR542_RS02395 (CR542_02390) | - | 443013..444185 (+) | 1173 | WP_013730173.1 | DEAD/DEAH box helicase family protein | - |
| CR542_RS02400 (CR542_02395) | - | 444259..444525 (+) | 267 | WP_226960629.1 | hypothetical protein | - |
| CR542_RS02405 (CR542_02400) | - | 444535..445233 (+) | 699 | WP_013730175.1 | ERF family protein | - |
| CR542_RS02410 (CR542_02405) | - | 445233..445529 (+) | 297 | WP_022540564.1 | hypothetical protein | - |
| CR542_RS02415 (CR542_02410) | ssbA | 445526..445924 (+) | 399 | WP_022540565.1 | single-stranded DNA-binding protein | Machinery gene |
| CR542_RS02420 (CR542_02415) | - | 445935..446762 (+) | 828 | WP_013730177.1 | bifunctional DNA primase/polymerase | - |
| CR542_RS02425 (CR542_02420) | - | 446746..448125 (+) | 1380 | WP_079253058.1 | virulence-associated E family protein | - |
| CR542_RS11635 | - | 448482..448637 (+) | 156 | WP_013730179.1 | hypothetical protein | - |
| CR542_RS02430 (CR542_02425) | - | 448634..448942 (+) | 309 | WP_013730180.1 | DUF1372 family protein | - |
| CR542_RS02435 (CR542_02430) | - | 448944..449159 (+) | 216 | WP_013730181.1 | hypothetical protein | - |
| CR542_RS02440 (CR542_02435) | - | 449348..449662 (+) | 315 | WP_013730182.1 | hypothetical protein | - |
| CR542_RS02445 (CR542_02440) | - | 449735..450169 (+) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| CR542_RS02450 (CR542_02445) | - | 450266..450613 (+) | 348 | WP_013730183.1 | HNH endonuclease | - |
| CR542_RS02455 (CR542_02450) | - | 450818..451063 (+) | 246 | WP_022540566.1 | hypothetical protein | - |
| CR542_RS02460 (CR542_02455) | - | 451060..452325 (+) | 1266 | WP_013730185.1 | phage portal protein | - |
| CR542_RS11640 | - | 452318..453538 (+) | 1221 | WP_013730186.1 | hypothetical protein | - |
| CR542_RS02470 (CR542_02465) | - | 453543..453776 (+) | 234 | WP_022540567.1 | hypothetical protein | - |
| CR542_RS02475 (CR542_02470) | - | 453978..455180 (-) | 1203 | WP_079714049.1 | IS110 family transposase | - |
| CR542_RS11745 (CR542_02475) | - | 455520..455775 (-) | 256 | Protein_444 | IS110 family transposase | - |
| CR542_RS11750 | - | 456084..456371 (+) | 288 | Protein_445 | ISL3 family transposase | - |
| CR542_RS02485 (CR542_02480) | - | 456895..457533 (-) | 639 | WP_009909540.1 | MBL fold metallo-hydrolase | - |
| CR542_RS02490 (CR542_02485) | - | 457641..460109 (+) | 2469 | WP_009909541.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14872.45 Da Isoelectric Point: 4.6583
>NTDB_id=252380 CR542_RS02415 WP_022540565.1 445526..445924(+) (ssbA) [Streptococcus suis strain HA0609]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=252380 CR542_RS02415 WP_022540565.1 445526..445924(+) (ssbA) [Streptococcus suis strain HA0609]
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.674 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.455 |
100 |
0.455 |
| ssbA | Streptococcus mutans UA159 |
44.697 |
100 |
0.447 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.128 |
82.576 |
0.447 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.386 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
48.113 |
80.303 |
0.386 |