Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | B2G65_RS03090 | Genome accession | NZ_CP022354 |
| Coordinates | 563892..564317 (+) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain GUR | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 554581..594552 | 563892..564317 | within | 0 |
Gene organization within MGE regions
Location: 554581..594552
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B2G65_RS03010 (B2G65_03010) | - | 554581..555747 (-) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
| B2G65_RS03015 (B2G65_03015) | - | 555929..557350 (-) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| B2G65_RS03020 (B2G65_03020) | - | 557365..557751 (-) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| B2G65_RS03025 (B2G65_03025) | - | 557735..558076 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS03030 (B2G65_03030) | - | 558274..558486 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| B2G65_RS03035 (B2G65_03035) | - | 558514..559233 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| B2G65_RS03040 (B2G65_03040) | - | 559331..559570 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| B2G65_RS03045 (B2G65_03045) | - | 559737..559922 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS03050 (B2G65_03050) | - | 559993..560244 (+) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| B2G65_RS03055 (B2G65_03055) | - | 560275..560412 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| B2G65_RS03060 (B2G65_03060) | - | 560506..561222 (+) | 717 | WP_011888683.1 | DnaD domain protein | - |
| B2G65_RS03065 (B2G65_03065) | - | 561209..561991 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| B2G65_RS09970 | - | 561982..562119 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| B2G65_RS03070 (B2G65_03070) | - | 562132..562485 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| B2G65_RS03075 (B2G65_03075) | - | 562466..562720 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| B2G65_RS03080 (B2G65_03080) | - | 562742..563224 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| B2G65_RS03085 (B2G65_03085) | - | 563225..563899 (+) | 675 | WP_014635611.1 | ERF family protein | - |
| B2G65_RS03090 (B2G65_03090) | ssb | 563892..564317 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| B2G65_RS03095 (B2G65_03095) | - | 564323..564526 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| B2G65_RS03100 (B2G65_03100) | - | 564526..564966 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| B2G65_RS03105 (B2G65_03105) | - | 564963..565319 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| B2G65_RS10285 (B2G65_03110) | - | 565316..565561 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| B2G65_RS03115 (B2G65_03115) | - | 565561..565797 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| B2G65_RS09975 | - | 565794..565964 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| B2G65_RS03120 (B2G65_03120) | - | 565961..566245 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| B2G65_RS03125 (B2G65_03125) | - | 566247..566879 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| B2G65_RS03130 (B2G65_03130) | - | 566884..567363 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| B2G65_RS09980 | - | 567360..567530 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| B2G65_RS03135 (B2G65_03135) | - | 567814..568248 (+) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B2G65_RS10105 | - | 568710..568844 (+) | 135 | Protein_560 | DNA modification methylase | - |
| B2G65_RS03145 (B2G65_03145) | - | 569187..569663 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| B2G65_RS03150 (B2G65_03150) | - | 569746..570957 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| B2G65_RS03155 (B2G65_03155) | - | 570971..572473 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| B2G65_RS03160 (B2G65_03160) | - | 572478..573971 (+) | 1494 | WP_014635607.1 | phage minor capsid protein | - |
| B2G65_RS03165 (B2G65_03165) | - | 573971..574198 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| B2G65_RS03170 (B2G65_03170) | - | 574285..574551 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| B2G65_RS03175 (B2G65_03175) | - | 574677..575291 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| B2G65_RS03180 (B2G65_03180) | - | 575295..576113 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| B2G65_RS03185 (B2G65_03185) | - | 576167..576583 (+) | 417 | WP_011888692.1 | hypothetical protein | - |
| B2G65_RS03190 (B2G65_03190) | - | 576573..576905 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| B2G65_RS03195 (B2G65_03195) | - | 576905..577261 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| B2G65_RS03200 (B2G65_03200) | - | 577258..577656 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| B2G65_RS03205 (B2G65_03205) | - | 577656..578117 (+) | 462 | WP_011018120.1 | phage tail tube protein | - |
| B2G65_RS03210 (B2G65_03210) | - | 578161..578595 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| B2G65_RS03215 (B2G65_03215) | - | 578599..579180 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| B2G65_RS03220 (B2G65_03220) | - | 579170..582430 (+) | 3261 | WP_093974595.1 | tape measure protein | - |
| B2G65_RS03225 (B2G65_03225) | - | 582427..583143 (+) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| B2G65_RS03230 (B2G65_03230) | - | 583140..585281 (+) | 2142 | WP_093974597.1 | phage tail spike protein | - |
| B2G65_RS03235 (B2G65_03235) | hylP | 585281..586300 (+) | 1020 | WP_093974599.1 | hyaluronidase HylP | - |
| B2G65_RS03240 (B2G65_03240) | - | 586313..588197 (+) | 1885 | Protein_580 | gp58-like family protein | - |
| B2G65_RS03245 (B2G65_03245) | - | 588209..588640 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| B2G65_RS03250 (B2G65_03250) | - | 588643..589275 (+) | 633 | WP_093974601.1 | hypothetical protein | - |
| B2G65_RS03255 (B2G65_03255) | - | 589285..589740 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| B2G65_RS03260 (B2G65_03260) | - | 589852..591057 (+) | 1206 | WP_093974603.1 | glucosaminidase domain-containing protein | - |
| B2G65_RS03265 (B2G65_03265) | - | 591197..591721 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| B2G65_RS03270 (B2G65_03270) | - | 591709..592575 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| B2G65_RS09985 | - | 592743..592955 (+) | 213 | WP_195764127.1 | hypothetical protein | - |
| B2G65_RS03280 (B2G65_03280) | sda3 | 593332..594132 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| B2G65_RS03285 (B2G65_03285) | prx | 594370..594552 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=238682 B2G65_RS03090 WP_011285575.1 563892..564317(+) (ssb) [Streptococcus pyogenes strain GUR]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=238682 B2G65_RS03090 WP_011285575.1 563892..564317(+) (ssb) [Streptococcus pyogenes strain GUR]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |