Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | B5D85_RS06990 | Genome accession | NZ_CP020082 |
| Coordinates | 1316149..1316568 (-) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain STAB120304 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1283765..1324865 | 1316149..1316568 | within | 0 |
Gene organization within MGE regions
Location: 1283765..1324865
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B5D85_RS06740 (B5D85_06720) | prx | 1283765..1283947 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| B5D85_RS06750 (B5D85_06730) | - | 1284293..1284868 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| B5D85_RS06760 (B5D85_06740) | spek | 1285344..1286123 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| B5D85_RS06765 (B5D85_06745) | - | 1286427..1287293 (-) | 867 | WP_076639317.1 | DUF334 domain-containing protein | - |
| B5D85_RS06770 (B5D85_06750) | - | 1287281..1287805 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| B5D85_RS06775 (B5D85_06755) | - | 1287945..1289147 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| B5D85_RS06780 (B5D85_06760) | - | 1289263..1289490 (-) | 228 | WP_011054444.1 | phage holin | - |
| B5D85_RS06785 (B5D85_06765) | - | 1289487..1289759 (-) | 273 | WP_011017397.1 | DUF7365 family protein | - |
| B5D85_RS10165 (B5D85_06770) | - | 1289771..1290286 (-) | 516 | WP_237372032.1 | hypothetical protein | - |
| B5D85_RS10350 | - | 1290258..1290404 (-) | 147 | WP_237372033.1 | hypothetical protein | - |
| B5D85_RS06795 (B5D85_06775) | - | 1290407..1290835 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| B5D85_RS06800 (B5D85_06780) | - | 1290847..1292736 (-) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| B5D85_RS06805 (B5D85_06785) | - | 1292747..1293061 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| B5D85_RS06810 (B5D85_06790) | - | 1293063..1294277 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| B5D85_RS06815 (B5D85_06795) | - | 1294274..1296421 (-) | 2148 | WP_076639318.1 | phage tail spike protein | - |
| B5D85_RS06820 (B5D85_06800) | - | 1296418..1297134 (-) | 717 | WP_076639319.1 | distal tail protein Dit | - |
| B5D85_RS06825 (B5D85_06805) | - | 1297131..1300391 (-) | 3261 | WP_076639320.1 | tape measure protein | - |
| B5D85_RS06830 (B5D85_06810) | - | 1300381..1300962 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| B5D85_RS06835 (B5D85_06815) | - | 1300966..1301400 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| B5D85_RS06840 (B5D85_06820) | - | 1301439..1301924 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| B5D85_RS06845 (B5D85_06825) | - | 1301924..1302322 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| B5D85_RS06850 (B5D85_06830) | - | 1302319..1302675 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| B5D85_RS06855 (B5D85_06835) | - | 1302675..1303007 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| B5D85_RS06860 (B5D85_06840) | - | 1302997..1303413 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| B5D85_RS06865 (B5D85_06845) | - | 1303467..1304285 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| B5D85_RS06870 (B5D85_06850) | - | 1304289..1304903 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| B5D85_RS06875 (B5D85_06855) | - | 1305029..1305295 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| B5D85_RS06880 (B5D85_06860) | - | 1305357..1305596 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| B5D85_RS06885 (B5D85_06865) | - | 1305568..1307046 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| B5D85_RS06890 (B5D85_06870) | - | 1307051..1308553 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| B5D85_RS06895 (B5D85_06875) | - | 1308567..1309778 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| B5D85_RS06900 (B5D85_06880) | - | 1309861..1310334 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| B5D85_RS06905 (B5D85_06885) | - | 1310385..1310762 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| B5D85_RS06910 (B5D85_06890) | - | 1310823..1311254 (-) | 432 | WP_074375320.1 | GNAT family N-acetyltransferase | - |
| B5D85_RS06915 (B5D85_06895) | - | 1311232..1311750 (-) | 519 | WP_076639322.1 | ParB N-terminal domain-containing protein | - |
| B5D85_RS06920 (B5D85_06900) | - | 1311831..1312088 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| B5D85_RS10175 | - | 1312727..1312870 (-) | 144 | Protein_1308 | ArpU family transcriptional regulator | - |
| B5D85_RS09995 | - | 1313104..1313274 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| B5D85_RS06945 (B5D85_06920) | - | 1313271..1313777 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| B5D85_RS09865 | - | 1313774..1313944 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| B5D85_RS06955 (B5D85_06925) | - | 1313941..1314345 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| B5D85_RS06960 (B5D85_06930) | - | 1314355..1314624 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| B5D85_RS06965 (B5D85_06935) | - | 1314621..1314905 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| B5D85_RS06970 (B5D85_06940) | - | 1314899..1315150 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| B5D85_RS06975 (B5D85_06945) | - | 1315147..1315503 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| B5D85_RS06980 (B5D85_06950) | - | 1315500..1315940 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| B5D85_RS06985 (B5D85_06955) | - | 1315940..1316143 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| B5D85_RS06990 (B5D85_06960) | ssbA | 1316149..1316568 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| B5D85_RS06995 (B5D85_06965) | - | 1316561..1317235 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| B5D85_RS07000 (B5D85_06970) | - | 1317236..1317718 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| B5D85_RS07005 (B5D85_06975) | - | 1317740..1317994 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| B5D85_RS07010 (B5D85_06980) | - | 1318005..1318145 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| B5D85_RS07015 (B5D85_06985) | - | 1318142..1318375 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| B5D85_RS07020 (B5D85_06990) | - | 1318356..1318769 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| B5D85_RS10180 (B5D85_06995) | - | 1318891..1319148 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| B5D85_RS07030 (B5D85_07000) | - | 1319242..1319427 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| B5D85_RS07035 (B5D85_07005) | - | 1319456..1319713 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| B5D85_RS07045 (B5D85_07015) | - | 1319959..1320126 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| B5D85_RS07050 (B5D85_07020) | - | 1320202..1320402 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| B5D85_RS10000 | - | 1320399..1320548 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| B5D85_RS07055 (B5D85_07025) | - | 1320581..1321309 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| B5D85_RS07060 (B5D85_07030) | - | 1321320..1321511 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| B5D85_RS07065 (B5D85_07035) | - | 1322313..1322666 (+) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| B5D85_RS07070 (B5D85_07040) | - | 1322680..1323060 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| B5D85_RS07075 (B5D85_07045) | - | 1323071..1323592 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| B5D85_RS07080 (B5D85_07050) | - | 1323768..1324865 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=220925 B5D85_RS06990 WP_011054759.1 1316149..1316568(-) (ssbA) [Streptococcus pyogenes strain STAB120304]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=220925 B5D85_RS06990 WP_011054759.1 1316149..1316568(-) (ssbA) [Streptococcus pyogenes strain STAB120304]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |