Detailed information NTG0210605

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: BTR42_RS00645
• Genome accession: NZ_CP018822
• Coordinates: 97184..97477 (+)
• Length: 97 a.a.
• NCBI ID: WP_039695588.1
• Uniprot ID: A0A060RJM4
• Organism: Streptococcus gallolyticus subsp. gallolyticus DSM 16831
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 92184..102477

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BTR42_RS00630 (BTR42_00395)	-	94837..95205 (+)	369	WP_074658936.1	DUF1033 family protein	-
BTR42_RS00635 (BTR42_00400)	comYA	95276..96217 (+)	942	WP_077495921.1	competence type IV pilus ATPase ComGA	Machinery gene
BTR42_RS00640 (BTR42_00405)	comYB	96099..97184 (+)	1086	WP_231873059.1	competence type IV pilus assembly protein ComGB	Machinery gene
BTR42_RS00645 (BTR42_00410)	comYC	97184..97477 (+)	294	WP_039695588.1	competence type IV pilus major pilin ComGC	Machinery gene
BTR42_RS00650 (BTR42_00415)	comYD	97461..97892 (+)	432	WP_009853232.1	competence type IV pilus minor pilin ComGD	Machinery gene
BTR42_RS00655 (BTR42_00420)	comGE	97846..98139 (+)	294	WP_012961329.1	competence type IV pilus minor pilin ComGE	-
BTR42_RS00660 (BTR42_00425)	comYF	98093..98560 (+)	468	WP_012961330.1	competence type IV pilus minor pilin ComGF	Machinery gene
BTR42_RS00665 (BTR42_00430)	comGG	98514..98864 (+)	351	WP_420031090.1	competence type IV pilus minor pilin ComGG	-
BTR42_RS00670 (BTR42_00435)	comYH	98919..99875 (+)	957	WP_009853236.1	class I SAM-dependent methyltransferase	Machinery gene
BTR42_RS00675 (BTR42_00440)	-	99928..101127 (+)	1200	WP_061458770.1	acetate kinase	-
BTR42_RS00680 (BTR42_00445)	-	101289..101489 (+)	201	WP_012961332.1	helix-turn-helix transcriptional regulator	-
BTR42_RS00690 (BTR42_00455)	-	101721..102173 (+)	453	WP_061458772.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11076.19 Da
• Isoelectric Point: 9.9310

>NTDB_id=210605 BTR42_RS00645 WP_039695588.1 97184..97477(+) (comYC) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
MKKFWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=210605 BTR42_RS00645 WP_039695588.1 97184..97477(+) (comYC) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
ATGAAAAAGTTTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCAACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

3D structure

• AlphaFold DB: A0A060RJM4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	67.391	94.845	0.639
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comGC/cglC	Streptococcus mitis SK321	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae D39	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae R6	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	96.907	0.577
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	96.907	0.577
comYC	Streptococcus mutans UA140	58.427	91.753	0.536
comYC	Streptococcus mutans UA159	58.427	91.753	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526
comGC	Staphylococcus aureus MW2	42.697	91.753	0.392
comGC	Staphylococcus aureus N315	42.697	91.753	0.392