Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | BSL41_RS01310 | Genome accession | NZ_CP018347 |
| Coordinates | 206273..206599 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738650.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain SWU02 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 201273..211599
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSL41_RS01270 | rnpA | 201297..201668 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| BSL41_RS12540 | - | 201685..201816 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| BSL41_RS01275 | - | 201817..203007 (-) | 1191 | WP_000167766.1 | acetate kinase | - |
| BSL41_RS01280 | comYH | 203058..204011 (-) | 954 | WP_000345119.1 | class I SAM-dependent methyltransferase | Machinery gene |
| BSL41_RS01285 | - | 204072..204659 (-) | 588 | WP_000679774.1 | class I SAM-dependent methyltransferase | - |
| BSL41_RS01290 | comGG/cglG | 204796..205209 (-) | 414 | WP_000265630.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BSL41_RS01295 | comGF/cglF | 205187..205648 (-) | 462 | WP_000250545.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BSL41_RS01300 | comGE/cglE | 205611..205913 (-) | 303 | WP_000413380.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BSL41_RS01305 | comGD/cglD | 205876..206280 (-) | 405 | WP_000588005.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| BSL41_RS01310 | comGC/cglC | 206273..206599 (-) | 327 | WP_000738650.1 | comG operon protein ComGC | Machinery gene |
| BSL41_RS01315 | comGB/cglB | 206601..207617 (-) | 1017 | WP_013193332.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| BSL41_RS01320 | comGA/cglA/cilD | 207565..208506 (-) | 942 | WP_000249567.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| BSL41_RS01325 | - | 208582..208947 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| BSL41_RS01330 | - | 209098..210156 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| BSL41_RS01335 | nagA | 210319..211470 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12189.35 Da Isoelectric Point: 10.0523
>NTDB_id=208201 BSL41_RS01310 WP_000738650.1 206273..206599(-) (comGC/cglC) [Streptococcus pneumoniae strain SWU02]
MKKMMTFLKKSKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQA
DGRITEEQAKAYKEYHDKNGVANRKVND
MKKMMTFLKKSKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQA
DGRITEEQAKAYKEYHDKNGVANRKVND
Nucleotide
Download Length: 327 bp
>NTDB_id=208201 BSL41_RS01310 WP_000738650.1 206273..206599(-) (comGC/cglC) [Streptococcus pneumoniae strain SWU02]
ATGAAAAAAATGATGACATTCTTGAAAAAATCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTACAAGCA
GATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGTAGCAAATCGTAAAGTCAA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAATCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTACAAGCA
GATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGTAGCAAATCGTAAAGTCAA
TGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
97.222 |
100 |
0.972 |
| comGC/cglC | Streptococcus pneumoniae D39 |
97.222 |
100 |
0.972 |
| comGC/cglC | Streptococcus pneumoniae R6 |
97.222 |
100 |
0.972 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
96.296 |
100 |
0.963 |
| comGC/cglC | Streptococcus mitis SK321 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.157 |
94.444 |
0.87 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
72.917 |
88.889 |
0.648 |
| comYC | Streptococcus mutans UA140 |
63.725 |
94.444 |
0.602 |
| comYC | Streptococcus mutans UA159 |
63.725 |
94.444 |
0.602 |
| comYC | Streptococcus suis isolate S10 |
70.37 |
75 |
0.528 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
54.902 |
94.444 |
0.519 |
| comGC | Staphylococcus aureus MW2 |
50 |
79.63 |
0.398 |
| comGC | Staphylococcus aureus N315 |
50 |
79.63 |
0.398 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
79.63 |
0.361 |