Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | BKM67_RS02805 | Genome accession | NZ_CP017667 |
| Coordinates | 554252..554650 (+) | Length | 132 a.a. |
| NCBI ID | WP_112477621.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain 1081 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 542764..581479 | 554252..554650 | within | 0 |
Gene organization within MGE regions
Location: 542764..581479
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BKM67_RS02695 (BKM67_02660) | - | 542764..543039 (+) | 276 | WP_024385016.1 | HU family DNA-binding protein | - |
| BKM67_RS02700 (BKM67_02665) | - | 543128..544270 (-) | 1143 | WP_112477612.1 | site-specific integrase | - |
| BKM67_RS02705 (BKM67_02670) | - | 544508..545374 (-) | 867 | WP_239495098.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| BKM67_RS02710 (BKM67_02675) | - | 545325..546056 (-) | 732 | WP_112477613.1 | S24 family peptidase | - |
| BKM67_RS02715 (BKM67_02680) | - | 546226..546444 (+) | 219 | WP_105155377.1 | helix-turn-helix transcriptional regulator | - |
| BKM67_RS02720 (BKM67_02685) | - | 546485..546751 (+) | 267 | WP_044669118.1 | hypothetical protein | - |
| BKM67_RS02725 (BKM67_02690) | - | 546744..546983 (-) | 240 | WP_105154140.1 | hypothetical protein | - |
| BKM67_RS02730 (BKM67_02695) | - | 547052..547402 (+) | 351 | WP_044669123.1 | hypothetical protein | - |
| BKM67_RS02735 (BKM67_02700) | - | 547569..547760 (+) | 192 | WP_105106019.1 | DNA-binding protein | - |
| BKM67_RS02740 (BKM67_02705) | - | 547844..548188 (+) | 345 | WP_112477614.1 | hypothetical protein | - |
| BKM67_RS02745 (BKM67_02710) | - | 548205..548516 (+) | 312 | WP_112477615.1 | excisionase | - |
| BKM67_RS02750 (BKM67_02715) | - | 548518..548802 (+) | 285 | WP_112477616.1 | hypothetical protein | - |
| BKM67_RS02755 (BKM67_02720) | - | 548795..549025 (+) | 231 | WP_024379789.1 | hypothetical protein | - |
| BKM67_RS02760 (BKM67_02725) | - | 549018..549242 (+) | 225 | WP_044667234.1 | hypothetical protein | - |
| BKM67_RS02765 (BKM67_02730) | - | 549246..549842 (+) | 597 | WP_044667233.1 | HNH endonuclease signature motif containing protein | - |
| BKM67_RS02770 (BKM67_02735) | - | 549826..550308 (+) | 483 | WP_044667232.1 | siphovirus Gp157 family protein | - |
| BKM67_RS02775 (BKM67_02740) | - | 550305..550769 (+) | 465 | WP_112477617.1 | hypothetical protein | - |
| BKM67_RS02780 (BKM67_02745) | - | 550738..551910 (+) | 1173 | WP_112477618.1 | DEAD/DEAH box helicase family protein | - |
| BKM67_RS02785 (BKM67_02750) | - | 552507..552677 (+) | 171 | WP_112477619.1 | CopG family transcriptional regulator | - |
| BKM67_RS02790 (BKM67_02755) | - | 552853..553092 (+) | 240 | WP_023371163.1 | hypothetical protein | - |
| BKM67_RS02795 (BKM67_02760) | - | 553085..553543 (+) | 459 | WP_024379781.1 | hypothetical protein | - |
| BKM67_RS02800 (BKM67_02765) | - | 553553..554251 (+) | 699 | WP_112477620.1 | ERF family protein | - |
| BKM67_RS02805 (BKM67_02770) | ssbA | 554252..554650 (+) | 399 | WP_112477621.1 | single-stranded DNA-binding protein | Machinery gene |
| BKM67_RS02810 (BKM67_02775) | - | 554661..555488 (+) | 828 | WP_112477622.1 | bifunctional DNA primase/polymerase | - |
| BKM67_RS02815 (BKM67_02780) | - | 555472..556860 (+) | 1389 | WP_112477623.1 | virulence-associated E family protein | - |
| BKM67_RS10910 | - | 557230..557385 (+) | 156 | WP_204355554.1 | hypothetical protein | - |
| BKM67_RS02820 (BKM67_02785) | - | 557382..557687 (+) | 306 | WP_112477624.1 | DUF1372 family protein | - |
| BKM67_RS02825 (BKM67_02790) | - | 557689..558123 (+) | 435 | WP_112477625.1 | hypothetical protein | - |
| BKM67_RS10865 | - | 558135..558314 (+) | 180 | WP_162636964.1 | hypothetical protein | - |
| BKM67_RS02830 (BKM67_02795) | - | 558343..558657 (+) | 315 | WP_112477626.1 | hypothetical protein | - |
| BKM67_RS02835 (BKM67_02800) | - | 558730..559164 (+) | 435 | WP_023371145.1 | DUF1492 domain-containing protein | - |
| BKM67_RS02845 (BKM67_02810) | - | 559630..560064 (+) | 435 | WP_112477627.1 | terminase small subunit | - |
| BKM67_RS02850 (BKM67_02815) | - | 560048..561343 (+) | 1296 | WP_112477628.1 | PBSX family phage terminase large subunit | - |
| BKM67_RS02855 (BKM67_02820) | - | 561347..562825 (+) | 1479 | WP_204355555.1 | phage portal protein | - |
| BKM67_RS02860 (BKM67_02825) | - | 562800..564206 (+) | 1407 | WP_239495099.1 | minor capsid protein | - |
| BKM67_RS02865 (BKM67_02830) | - | 564365..564688 (+) | 324 | WP_105154123.1 | hypothetical protein | - |
| BKM67_RS02870 (BKM67_02835) | - | 564681..564860 (+) | 180 | WP_204355556.1 | hypothetical protein | - |
| BKM67_RS02875 (BKM67_02840) | - | 564853..565101 (+) | 249 | WP_112477630.1 | hypothetical protein | - |
| BKM67_RS02880 (BKM67_02845) | - | 565112..565363 (+) | 252 | WP_112477631.1 | DUF6275 family protein | - |
| BKM67_RS02885 (BKM67_02850) | - | 565537..566088 (+) | 552 | WP_112477632.1 | DUF4355 domain-containing protein | - |
| BKM67_RS02890 (BKM67_02855) | - | 566101..566994 (+) | 894 | WP_024415123.1 | phage major capsid protein | - |
| BKM67_RS02895 (BKM67_02860) | - | 567010..567321 (+) | 312 | WP_079395927.1 | hypothetical protein | - |
| BKM67_RS02900 (BKM67_02865) | - | 567324..567671 (+) | 348 | WP_112477633.1 | phage head-tail connector protein | - |
| BKM67_RS02905 (BKM67_02870) | - | 567668..567973 (+) | 306 | WP_112477634.1 | hypothetical protein | - |
| BKM67_RS02910 (BKM67_02875) | - | 567974..568318 (+) | 345 | WP_112477635.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BKM67_RS02915 (BKM67_02880) | - | 568315..568698 (+) | 384 | WP_112477636.1 | hypothetical protein | - |
| BKM67_RS02920 (BKM67_02885) | - | 568699..569241 (+) | 543 | WP_015984468.1 | phage major tail protein, TP901-1 family | - |
| BKM67_RS02925 (BKM67_02890) | - | 569289..569630 (+) | 342 | WP_015984469.1 | tail assembly chaperone | - |
| BKM67_RS02930 (BKM67_02895) | - | 569702..570004 (+) | 303 | WP_112477637.1 | hypothetical protein | - |
| BKM67_RS02935 (BKM67_02900) | - | 570004..572964 (+) | 2961 | WP_204355557.1 | hypothetical protein | - |
| BKM67_RS02940 (BKM67_02905) | - | 572978..573769 (+) | 792 | WP_112477638.1 | distal tail protein Dit | - |
| BKM67_RS02945 (BKM67_02910) | - | 573766..578298 (+) | 4533 | WP_112477639.1 | phage tail spike protein | - |
| BKM67_RS02950 (BKM67_02915) | - | 578317..578553 (+) | 237 | WP_112477640.1 | hypothetical protein | - |
| BKM67_RS10915 (BKM67_02920) | - | 578550..579056 (+) | 507 | WP_112477641.1 | DUF1366 domain-containing protein | - |
| BKM67_RS02960 (BKM67_02925) | - | 579060..579272 (+) | 213 | WP_044474163.1 | hypothetical protein | - |
| BKM67_RS02965 (BKM67_02930) | - | 579274..579693 (+) | 420 | WP_112477642.1 | hypothetical protein | - |
| BKM67_RS02970 (BKM67_02935) | - | 579705..580025 (+) | 321 | WP_336384299.1 | phage holin | - |
| BKM67_RS02975 (BKM67_02940) | - | 580028..581479 (+) | 1452 | WP_112477644.1 | peptidoglycan amidohydrolase family protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14802.33 Da Isoelectric Point: 4.6582
>NTDB_id=201351 BKM67_RS02805 WP_112477621.1 554252..554650(+) (ssbA) [Streptococcus suis strain 1081]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSSGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSSGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=201351 BKM67_RS02805 WP_112477621.1 554252..554650(+) (ssbA) [Streptococcus suis strain 1081]
ATGATAAATAATGTAGTATTGGTAGGTCGCATGACCCGTGATGCAGAACTTCGCTATACTCCGTCAAATCAGGCAGTTGC
GACTTTTACCTTGGCTGTCAATCGAAATTTCAAAAACCAAGATGGCGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCCAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTGTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGCCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATCTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATAAATAATGTAGTATTGGTAGGTCGCATGACCCGTGATGCAGAACTTCGCTATACTCCGTCAAATCAGGCAGTTGC
GACTTTTACCTTGGCTGTCAATCGAAATTTCAAAAACCAAGATGGCGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCCAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTGTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGCCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATCTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.682 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.97 |
100 |
0.47 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.212 |
100 |
0.462 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.963 |
82.576 |
0.462 |
| ssbA | Streptococcus mutans UA159 |
44.697 |
100 |
0.447 |
| ssb | Vibrio cholerae strain A1552 |
28.902 |
100 |
0.379 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.17 |
80.303 |
0.379 |