Detailed information NTG0195000

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: BGL51_RS09070
• Genome accession: NZ_CP017064
• Coordinates: 1714420..1714746 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain ST3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1709420..1719746

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BGL51_RS10705 (BGL51_08915)	-	1709686..1710024 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
BGL51_RS10710 (BGL51_08920)	-	1710068..1710343 (-)	276	WP_011681681.1	hypothetical protein	-
BGL51_RS09035 (BGL51_08925)	-	1710355..1710552 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
BGL51_RS09040 (BGL51_08930)	-	1710801..1711994 (-)	1194	Protein_1685	acetate kinase	-
BGL51_RS09045 (BGL51_08935)	comYH	1712050..1713006 (-)	957	WP_095559463.1	class I SAM-dependent methyltransferase	Machinery gene
BGL51_RS09050 (BGL51_08940)	comGG	1713051..1713368 (-)	318	WP_095559464.1	competence type IV pilus minor pilin ComGG	-
BGL51_RS09055 (BGL51_08945)	comYF	1713346..1713783 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
BGL51_RS09060 (BGL51_08950)	comGE	1713767..1714060 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	-
BGL51_RS09065 (BGL51_08955)	comGD	1714032..1714460 (-)	429	WP_253269448.1	competence type IV pilus minor pilin ComGD	-
BGL51_RS09070 (BGL51_08960)	comYC	1714420..1714746 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
BGL51_RS09075 (BGL51_08965)	comYB	1714743..1715843 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
BGL51_RS09080 (BGL51_08970)	comYA	1715725..1716666 (-)	942	WP_084829888.1	competence type IV pilus ATPase ComGA	Machinery gene
BGL51_RS09085 (BGL51_08975)	-	1716747..1717109 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=195000 BGL51_RS09070 WP_002946126.1 1714420..1714746(-) (comYC) [Streptococcus thermophilus strain ST3]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=195000 BGL51_RS09070 WP_002946126.1 1714420..1714746(-) (comYC) [Streptococcus thermophilus strain ST3]
ATGAAATTGATGTTAAAAAAATTGAATGCTGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361