Detailed information
Bioinformatically predicted
Overview
| Name | ssbB/cilA | Type | Machinery gene |
| Locus tag | RN86_RS04255 | Genome accession | NZ_CP012648 |
| Coordinates | 858736..859131 (-) | Length | 131 a.a. |
| NCBI ID | WP_046164720.1 | Uniprot ID | A0A0F5MM81 |
| Organism | Streptococcus gordonii strain KCOM 1506 (= ChDC B679) | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 856211..879902 | 858736..859131 | within | 0 |
Gene organization within MGE regions
Location: 856211..879902
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RN86_RS04240 (RN86_04235) | - | 856211..856414 (+) | 204 | WP_046164722.1 | helix-turn-helix transcriptional regulator | - |
| RN86_RS11460 | - | 856411..856575 (+) | 165 | WP_082730221.1 | hypothetical protein | - |
| RN86_RS04245 (RN86_04240) | - | 856585..857019 (+) | 435 | WP_046164721.1 | hypothetical protein | - |
| RN86_RS04250 (RN86_04245) | - | 857073..858557 (-) | 1485 | WP_053794892.1 | DUF1846 domain-containing protein | - |
| RN86_RS04255 (RN86_04250) | ssbB/cilA | 858736..859131 (-) | 396 | WP_046164720.1 | single-stranded DNA-binding protein | Machinery gene |
| RN86_RS04260 (RN86_04255) | ytpR | 859195..859821 (-) | 627 | WP_046164719.1 | YtpR family tRNA-binding protein | - |
| RN86_RS04265 (RN86_04260) | - | 859838..860155 (-) | 318 | WP_046164718.1 | thioredoxin family protein | - |
| RN86_RS04270 (RN86_04265) | - | 860155..860439 (-) | 285 | WP_053794333.1 | DUF4651 domain-containing protein | - |
| RN86_RS04275 (RN86_04270) | pepA | 860620..861687 (+) | 1068 | WP_053794334.1 | glutamyl aminopeptidase | - |
| RN86_RS04280 (RN86_04275) | - | 861936..862922 (+) | 987 | WP_125377546.1 | substrate-binding domain-containing protein | - |
| RN86_RS04285 (RN86_04280) | - | 862922..864235 (+) | 1314 | WP_046164715.1 | sensor histidine kinase | - |
| RN86_RS04290 (RN86_04285) | - | 864228..864911 (+) | 684 | WP_002896732.1 | response regulator transcription factor | - |
| RN86_RS04295 (RN86_04290) | - | 864908..866191 (+) | 1284 | WP_053794335.1 | sugar ABC transporter substrate-binding protein | - |
| RN86_RS04300 (RN86_04295) | - | 866408..866845 (+) | 438 | WP_053794336.1 | PTS fructose transporter subunit IIA | - |
| RN86_RS04305 (RN86_04300) | - | 866866..867360 (+) | 495 | WP_008810035.1 | PTS sugar transporter subunit IIB | - |
| RN86_RS04310 (RN86_04305) | - | 867391..868242 (+) | 852 | WP_008810034.1 | PTS sugar transporter subunit IIC | - |
| RN86_RS04315 (RN86_04310) | - | 868244..869074 (+) | 831 | WP_048777245.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| RN86_RS04320 (RN86_04315) | - | 869086..869376 (+) | 291 | WP_046164712.1 | hypothetical protein | - |
| RN86_RS04325 (RN86_04320) | - | 869779..871752 (+) | 1974 | WP_046164711.1 | ABC transporter substrate binding protein | - |
| RN86_RS04330 (RN86_04325) | - | 871752..872555 (+) | 804 | WP_046164710.1 | ATP-binding cassette domain-containing protein | - |
| RN86_RS04335 (RN86_04330) | groES | 872716..872997 (+) | 282 | WP_012130907.1 | co-chaperone GroES | - |
| RN86_RS04340 (RN86_04335) | groL | 873020..874642 (+) | 1623 | WP_045634142.1 | chaperonin GroEL | - |
| RN86_RS04345 (RN86_04340) | - | 874766..875524 (+) | 759 | WP_045634141.1 | epoxyqueuosine reductase QueH | - |
| RN86_RS04350 (RN86_04345) | - | 875618..876439 (-) | 822 | WP_046164708.1 | PrsW family glutamic-type intramembrane protease | - |
| RN86_RS04355 (RN86_04350) | folE | 876487..877050 (-) | 564 | WP_008810025.1 | GTP cyclohydrolase I FolE | - |
| RN86_RS04360 (RN86_04355) | rpsF | 877262..877552 (+) | 291 | WP_002896497.1 | 30S ribosomal protein S6 | - |
| RN86_RS04365 (RN86_04360) | ssb | 877569..878060 (+) | 492 | WP_046164707.1 | single-stranded DNA-binding protein | Machinery gene |
| RN86_RS04370 (RN86_04365) | rpsR | 878099..878338 (+) | 240 | WP_000068664.1 | 30S ribosomal protein S18 | - |
| RN86_RS04375 (RN86_04370) | - | 878392..879048 (+) | 657 | WP_080998581.1 | TetR/AcrR family transcriptional regulator | - |
| RN86_RS04380 (RN86_04375) | - | 879189..879902 (+) | 714 | WP_046164705.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14776.67 Da Isoelectric Point: 6.2467
>NTDB_id=156078 RN86_RS04255 WP_046164720.1 858736..859131(-) (ssbB/cilA) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
MYNKVIIIGRLTATPELHKTSNEKSVTRATIAVNRRFKDQNGEREADFINIVLWGKLAETLASYASKGSLISLDGELRTR
RYEKDGVTHYVTEVLGHGFQLLESRAQRAIRENNSGADLADLVLEEEELPF
MYNKVIIIGRLTATPELHKTSNEKSVTRATIAVNRRFKDQNGEREADFINIVLWGKLAETLASYASKGSLISLDGELRTR
RYEKDGVTHYVTEVLGHGFQLLESRAQRAIRENNSGADLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=156078 RN86_RS04255 WP_046164720.1 858736..859131(-) (ssbB/cilA) [Streptococcus gordonii strain KCOM 1506 (= ChDC B679)]
ATGTACAATAAAGTCATTATTATCGGTCGTTTGACGGCCACACCAGAATTGCACAAAACTAGCAATGAAAAATCTGTCAC
ACGCGCAACAATTGCTGTTAACCGTCGTTTTAAGGACCAAAATGGTGAACGTGAAGCAGACTTTATCAATATCGTCCTTT
GGGGCAAATTGGCTGAGACTCTAGCTAGTTATGCCAGCAAAGGAAGCTTAATTTCTCTGGACGGCGAACTACGGACCCGT
CGTTATGAAAAAGACGGTGTGACTCACTATGTCACAGAAGTCCTTGGACATGGTTTCCAGCTTCTTGAAAGTCGTGCCCA
GCGGGCTATTCGTGAAAATAATTCTGGAGCCGATTTGGCTGACCTAGTCTTGGAAGAAGAGGAACTTCCTTTCTAA
ATGTACAATAAAGTCATTATTATCGGTCGTTTGACGGCCACACCAGAATTGCACAAAACTAGCAATGAAAAATCTGTCAC
ACGCGCAACAATTGCTGTTAACCGTCGTTTTAAGGACCAAAATGGTGAACGTGAAGCAGACTTTATCAATATCGTCCTTT
GGGGCAAATTGGCTGAGACTCTAGCTAGTTATGCCAGCAAAGGAAGCTTAATTTCTCTGGACGGCGAACTACGGACCCGT
CGTTATGAAAAAGACGGTGTGACTCACTATGTCACAGAAGTCCTTGGACATGGTTTCCAGCTTCTTGAAAGTCGTGCCCA
GCGGGCTATTCGTGAAAATAATTCTGGAGCCGATTTGGCTGACCTAGTCTTGGAAGAAGAGGAACTTCCTTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
83.969 |
100 |
0.84 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
83.969 |
100 |
0.84 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
83.969 |
100 |
0.84 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
83.969 |
100 |
0.84 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
83.969 |
100 |
0.84 |
| ssbB/cilA | Streptococcus mitis SK321 |
83.206 |
100 |
0.832 |
| ssbA | Streptococcus mutans UA159 |
81.679 |
100 |
0.817 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
75.573 |
100 |
0.756 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
63.393 |
85.496 |
0.542 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.943 |
80.916 |
0.412 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50 |
80.916 |
0.405 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
45.37 |
82.443 |
0.374 |