Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ABO05_RS03120 | Genome accession | NZ_CP011535 |
| Coordinates | 617725..618144 (+) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain M28PF1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 609428..651457 | 617725..618144 | within | 0 |
Gene organization within MGE regions
Location: 609428..651457
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABO05_RS03040 (ABO05_03020) | - | 609428..610525 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| ABO05_RS03045 (ABO05_03025) | - | 610701..611222 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| ABO05_RS03050 (ABO05_03030) | - | 611233..611613 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABO05_RS03055 (ABO05_03035) | - | 611627..611986 (-) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| ABO05_RS03060 (ABO05_03040) | - | 612782..612973 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| ABO05_RS03065 (ABO05_03045) | - | 612984..613712 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| ABO05_RS10060 | - | 613745..613894 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| ABO05_RS03070 (ABO05_03050) | - | 613891..614091 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| ABO05_RS09515 | - | 614167..614334 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| ABO05_RS03080 (ABO05_03060) | - | 614580..614837 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| ABO05_RS03085 (ABO05_03065) | - | 614866..615051 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| ABO05_RS03090 (ABO05_03070) | - | 615145..615402 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| ABO05_RS03095 (ABO05_03075) | - | 615524..615937 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| ABO05_RS03100 (ABO05_03080) | - | 615918..616151 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| ABO05_RS10065 | - | 616148..616288 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| ABO05_RS03105 (ABO05_03085) | - | 616299..616553 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| ABO05_RS03110 (ABO05_03090) | - | 616575..617057 (+) | 483 | WP_047297970.1 | siphovirus Gp157 family protein | - |
| ABO05_RS03115 (ABO05_03095) | - | 617058..617732 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| ABO05_RS03120 (ABO05_03100) | ssbA | 617725..618144 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| ABO05_RS03125 (ABO05_03105) | - | 618150..618353 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| ABO05_RS03130 (ABO05_03110) | - | 618353..618793 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABO05_RS03135 (ABO05_03115) | - | 618790..619146 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| ABO05_RS03140 (ABO05_03120) | - | 619143..619394 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| ABO05_RS03145 (ABO05_03125) | - | 619388..619672 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| ABO05_RS03150 (ABO05_03130) | - | 619669..619938 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| ABO05_RS03155 (ABO05_03135) | - | 619948..620352 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| ABO05_RS10070 | - | 620349..620519 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| ABO05_RS03160 (ABO05_03140) | - | 620516..621022 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| ABO05_RS10075 | - | 621019..621189 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| ABO05_RS03165 (ABO05_03145) | - | 621463..621903 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ABO05_RS09535 | - | 622542..622799 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| ABO05_RS03170 (ABO05_03150) | - | 622880..623398 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABO05_RS03175 (ABO05_03155) | - | 623377..624054 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABO05_RS10080 (ABO05_03160) | - | 624063..624446 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABO05_RS03185 (ABO05_03165) | - | 624507..624884 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABO05_RS03190 (ABO05_03170) | - | 624926..625408 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| ABO05_RS03195 (ABO05_03175) | - | 625491..626702 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABO05_RS03200 (ABO05_03180) | - | 626716..628218 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABO05_RS03205 (ABO05_03185) | - | 628223..629701 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABO05_RS03210 (ABO05_03190) | - | 629673..629912 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABO05_RS03215 (ABO05_03195) | - | 629974..630240 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABO05_RS03220 (ABO05_03200) | - | 630366..630980 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABO05_RS03225 (ABO05_03205) | - | 630984..631802 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABO05_RS03230 (ABO05_03210) | - | 631856..632272 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABO05_RS03235 (ABO05_03215) | - | 632262..632594 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABO05_RS03240 (ABO05_03220) | - | 632594..632950 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABO05_RS03245 (ABO05_03225) | - | 632947..633345 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABO05_RS03250 (ABO05_03230) | - | 633345..633830 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABO05_RS03255 (ABO05_03235) | - | 633869..634303 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABO05_RS03260 (ABO05_03240) | - | 634307..634888 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| ABO05_RS03265 (ABO05_03245) | - | 634878..638138 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| ABO05_RS03270 (ABO05_03250) | - | 638135..638851 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABO05_RS03275 (ABO05_03255) | - | 638848..640995 (+) | 2148 | WP_047297976.1 | phage tail spike protein | - |
| ABO05_RS03280 (ABO05_03260) | - | 640992..642206 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABO05_RS03285 (ABO05_03265) | - | 642208..642522 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ABO05_RS03290 (ABO05_03270) | - | 642533..644419 (+) | 1887 | WP_047297978.1 | gp58-like family protein | - |
| ABO05_RS03295 (ABO05_03275) | - | 644431..644862 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| ABO05_RS03300 (ABO05_03280) | - | 644865..645476 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| ABO05_RS03305 (ABO05_03285) | - | 645487..645783 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| ABO05_RS03310 (ABO05_03290) | - | 645780..645965 (+) | 186 | WP_011054731.1 | holin | - |
| ABO05_RS03315 (ABO05_03300) | - | 646076..647278 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| ABO05_RS03320 (ABO05_03305) | - | 647418..647942 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ABO05_RS03325 (ABO05_03310) | - | 647930..648796 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| ABO05_RS03330 (ABO05_03315) | spek | 649099..649878 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| ABO05_RS03335 (ABO05_03320) | - | 650354..650929 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| ABO05_RS03345 (ABO05_03330) | prx | 651275..651457 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=146809 ABO05_RS03120 WP_011054759.1 617725..618144(+) (ssbA) [Streptococcus pyogenes strain M28PF1]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=146809 ABO05_RS03120 WP_011054759.1 617725..618144(+) (ssbA) [Streptococcus pyogenes strain M28PF1]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |