Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SPAP1_RS04275 | Genome accession | NZ_CP007537 |
| Coordinates | 827357..827782 (+) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 815771..856990 | 827357..827782 | within | 0 |
Gene organization within MGE regions
Location: 815771..856990
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPAP1_RS04180 (SPAP1_04165) | - | 815771..816391 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| SPAP1_RS04185 (SPAP1_04170) | - | 816754..817842 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| SPAP1_RS04190 (SPAP1_04175) | - | 817963..818856 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| SPAP1_RS04195 (SPAP1_04180) | - | 818892..819716 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS09875 | - | 820073..820231 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| SPAP1_RS04200 (SPAP1_04185) | - | 820261..820860 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| SPAP1_RS04205 (SPAP1_04190) | - | 820914..821123 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| SPAP1_RS04210 (SPAP1_04195) | - | 821112..821498 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| SPAP1_RS04215 (SPAP1_04200) | - | 821572..821772 (+) | 201 | WP_002992770.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS04220 (SPAP1_04205) | - | 821882..822091 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| SPAP1_RS04225 (SPAP1_04210) | - | 822222..822731 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| SPAP1_RS04230 (SPAP1_04215) | - | 822786..823049 (+) | 264 | WP_029714276.1 | hypothetical protein | - |
| SPAP1_RS04235 (SPAP1_04220) | - | 823086..823382 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| SPAP1_RS10580 | - | 823379..823513 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| SPAP1_RS04240 (SPAP1_04225) | - | 823529..823843 (+) | 315 | WP_023610888.1 | helix-turn-helix transcriptional regulator | - |
| SPAP1_RS04245 (SPAP1_04230) | - | 823857..824687 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SPAP1_RS04250 (SPAP1_04235) | - | 824674..825456 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| SPAP1_RS04255 (SPAP1_04240) | - | 825597..825950 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| SPAP1_RS04260 (SPAP1_04245) | - | 825931..826185 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPAP1_RS04265 (SPAP1_04250) | - | 826207..826689 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPAP1_RS04270 (SPAP1_04255) | - | 826690..827364 (+) | 675 | WP_029714396.1 | ERF family protein | - |
| SPAP1_RS04275 (SPAP1_04260) | ssb | 827357..827782 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SPAP1_RS04280 (SPAP1_04265) | - | 827788..827991 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPAP1_RS04285 (SPAP1_04270) | - | 827991..828431 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPAP1_RS04290 (SPAP1_04275) | - | 828428..828784 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| SPAP1_RS10645 (SPAP1_04280) | - | 828781..829026 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| SPAP1_RS04300 (SPAP1_04285) | - | 829133..829765 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SPAP1_RS04305 (SPAP1_04290) | - | 829768..830292 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| SPAP1_RS04310 (SPAP1_04295) | - | 830289..830555 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| SPAP1_RS04315 (SPAP1_04300) | - | 830841..831275 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPAP1_RS04320 (SPAP1_04305) | - | 831885..832265 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| SPAP1_RS04325 (SPAP1_04310) | - | 832255..833529 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| SPAP1_RS04330 (SPAP1_04315) | - | 833529..834854 (+) | 1326 | WP_029714009.1 | phage portal protein | - |
| SPAP1_RS04335 (SPAP1_04320) | - | 834823..835731 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| SPAP1_RS04340 (SPAP1_04325) | - | 835738..836007 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| SPAP1_RS10585 | - | 836009..836143 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| SPAP1_RS04345 (SPAP1_04330) | - | 836252..836821 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| SPAP1_RS04350 (SPAP1_04335) | - | 836840..837730 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| SPAP1_RS04355 (SPAP1_04340) | - | 837743..838036 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| SPAP1_RS04360 (SPAP1_04345) | - | 838050..838388 (+) | 339 | WP_029714010.1 | hypothetical protein | - |
| SPAP1_RS04365 (SPAP1_04350) | - | 838385..838696 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| SPAP1_RS04370 (SPAP1_04355) | - | 838693..839088 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| SPAP1_RS04375 (SPAP1_04360) | - | 839090..839500 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| SPAP1_RS04380 (SPAP1_04365) | - | 839512..840018 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| SPAP1_RS04385 (SPAP1_04370) | - | 840031..840348 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| SPAP1_RS04390 (SPAP1_04375) | - | 840321..840779 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| SPAP1_RS04395 (SPAP1_04380) | - | 840772..842577 (+) | 1806 | WP_011054802.1 | tail protein | - |
| SPAP1_RS04400 (SPAP1_04385) | - | 842578..844062 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| SPAP1_RS04405 (SPAP1_04390) | - | 844063..847503 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| SPAP1_RS04410 (SPAP1_04395) | - | 847508..849370 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| SPAP1_RS04415 (SPAP1_04400) | - | 849381..849728 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| SPAP1_RS10590 (SPAP1_04405) | - | 849742..849864 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| SPAP1_RS04425 (SPAP1_04410) | - | 849878..850201 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| SPAP1_RS04430 (SPAP1_04415) | - | 850201..850533 (+) | 333 | WP_011285562.1 | phage holin | - |
| SPAP1_RS04435 (SPAP1_04420) | - | 850535..851299 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| SPAP1_RS04440 (SPAP1_04425) | - | 851311..851913 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| SPAP1_RS04445 (SPAP1_04430) | - | 851924..852697 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| SPAP1_RS04450 (SPAP1_04435) | - | 852707..852928 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| SPAP1_RS04455 (SPAP1_04440) | - | 852928..853587 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| SPAP1_RS04460 (SPAP1_04445) | speA | 853709..854464 (-) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SPAP1_RS04465 (SPAP1_04450) | prx | 854685..854873 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| SPAP1_RS04470 (SPAP1_04455) | - | 855464..856078 (+) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| SPAP1_RS04475 (SPAP1_04460) | - | 856205..856990 (-) | 786 | WP_010922378.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=120628 SPAP1_RS04275 WP_011285575.1 827357..827782(+) (ssb) [Streptococcus pyogenes strain AP1]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=120628 SPAP1_RS04275 WP_011285575.1 827357..827782(+) (ssb) [Streptococcus pyogenes strain AP1]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |