Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | EW021_RS05345 | Genome accession | NZ_LR130236 |
| Coordinates | 1028704..1029129 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 5448 isolate 5448 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 993445..1039755 | 1028704..1029129 | within | 0 |
Gene organization within MGE regions
Location: 993445..1039755
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW021_RS05115 | pfkA | 993445..994458 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| EW021_RS05120 | - | 994538..997648 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| EW021_RS05125 | - | 997833..998204 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| EW021_RS05130 | - | 998204..998902 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| EW021_RS05135 | - | 998912..999697 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| EW021_RS05140 | - | 999824..1000438 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| EW021_RS05150 | prx | 1001029..1001217 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| EW021_RS05155 | speA | 1001437..1002192 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| EW021_RS05160 | - | 1002314..1002973 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| EW021_RS05165 | - | 1002973..1003194 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| EW021_RS05170 | - | 1003204..1003977 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| EW021_RS05175 | - | 1003988..1004590 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| EW021_RS05180 | - | 1004602..1005366 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| EW021_RS05185 | - | 1005368..1005700 (-) | 333 | WP_011285562.1 | phage holin | - |
| EW021_RS05190 | - | 1005700..1006023 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| EW021_RS09675 | - | 1006037..1006159 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| EW021_RS05195 | - | 1006173..1006520 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| EW021_RS05200 | - | 1006531..1008393 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| EW021_RS05205 | - | 1008398..1011838 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| EW021_RS05210 | - | 1011839..1013323 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| EW021_RS05215 | - | 1013324..1015129 (-) | 1806 | WP_011054802.1 | tail protein | - |
| EW021_RS05220 | - | 1015122..1015580 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| EW021_RS05225 | - | 1015553..1015870 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| EW021_RS05230 | - | 1015883..1016389 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| EW021_RS05235 | - | 1016401..1016811 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| EW021_RS05240 | - | 1016813..1017208 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| EW021_RS05245 | - | 1017205..1017516 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| EW021_RS05250 | - | 1017513..1017857 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| EW021_RS05255 | - | 1017871..1018164 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| EW021_RS05260 | - | 1018177..1019067 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| EW021_RS05265 | - | 1019086..1019655 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| EW021_RS09680 | - | 1019764..1019898 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| EW021_RS05270 | - | 1019900..1020169 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| EW021_RS05275 | - | 1020176..1021084 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| EW021_RS05280 | - | 1021053..1022378 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| EW021_RS05285 | - | 1022378..1023652 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| EW021_RS05290 | - | 1023642..1024022 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| EW021_RS05295 | - | 1024632..1025066 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EW021_RS05300 | - | 1025352..1025618 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| EW021_RS05305 | - | 1025615..1026139 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| EW021_RS05310 | - | 1026142..1026774 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| EW021_RS05315 | - | 1026776..1027060 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| EW021_RS09450 | - | 1027057..1027227 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| EW021_RS05320 | - | 1027224..1027460 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| EW021_RS09715 | - | 1027460..1027705 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| EW021_RS05330 | - | 1027702..1028058 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| EW021_RS05335 | - | 1028055..1028495 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EW021_RS05340 | - | 1028495..1028698 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| EW021_RS05345 | ssb | 1028704..1029129 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| EW021_RS05350 | - | 1029122..1029796 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| EW021_RS05355 | - | 1029797..1030279 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| EW021_RS05360 | - | 1030301..1030555 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| EW021_RS05365 | - | 1030536..1030889 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| EW021_RS05370 | - | 1031030..1031812 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| EW021_RS05375 | - | 1031799..1032629 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EW021_RS09605 | - | 1032643..1032831 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| EW021_RS09610 | - | 1033065..1033304 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| EW021_RS05390 | - | 1033435..1033644 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| EW021_RS05395 | - | 1033754..1033954 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| EW021_RS05400 | - | 1034028..1034414 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| EW021_RS05405 | - | 1034403..1034612 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| EW021_RS05410 | - | 1034666..1035265 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| EW021_RS05415 | - | 1035295..1035453 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| EW021_RS05420 | - | 1035810..1036634 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| EW021_RS05425 | - | 1036670..1037563 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| EW021_RS05430 | - | 1037684..1038772 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| EW021_RS05435 | - | 1039135..1039755 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=1116508 EW021_RS05345 WP_011285575.1 1028704..1029129(-) (ssb) [Streptococcus pyogenes strain 5448 isolate 5448]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1116508 EW021_RS05345 WP_011285575.1 1028704..1029129(-) (ssb) [Streptococcus pyogenes strain 5448 isolate 5448]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |