Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SP119_RS05530 | Genome accession | NZ_LR031521 |
| Coordinates | 1051832..1052257 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain S119 isolate S119 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1016573..1062883 | 1051832..1052257 | within | 0 |
Gene organization within MGE regions
Location: 1016573..1062883
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP119_RS05300 (SP119_0991) | pfkA | 1016573..1017586 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| SP119_RS05305 (SP119_0992) | - | 1017666..1020776 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| SP119_RS05310 (SP119_0993) | - | 1020961..1021332 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| SP119_RS05315 (SP119_0994) | - | 1021332..1022030 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| SP119_RS05320 (SP119_0995) | - | 1022040..1022825 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| SP119_RS05325 (SP119_0996) | - | 1022952..1023566 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| SP119_RS05335 (SP119_0997) | prx | 1024157..1024345 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| SP119_RS05340 (SP119_0998) | speA | 1024565..1025320 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SP119_RS05345 (SP119_0999) | - | 1025442..1026101 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| SP119_RS05350 (SP119_1000) | - | 1026101..1026322 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| SP119_RS05355 (SP119_1001) | - | 1026332..1027105 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| SP119_RS05360 (SP119_1002) | - | 1027116..1027718 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| SP119_RS05365 (SP119_1003) | - | 1027730..1028494 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| SP119_RS05370 (SP119_1004) | - | 1028496..1028828 (-) | 333 | WP_011285562.1 | phage holin | - |
| SP119_RS05375 (SP119_1005) | - | 1028828..1029151 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| SP119_RS10005 (SP119_1006) | - | 1029165..1029287 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| SP119_RS05380 (SP119_1007) | - | 1029301..1029648 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| SP119_RS05385 (SP119_1008) | - | 1029659..1031521 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| SP119_RS05390 (SP119_1009) | - | 1031526..1034966 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| SP119_RS05395 (SP119_1010) | - | 1034967..1036451 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| SP119_RS05400 (SP119_1011) | - | 1036452..1038257 (-) | 1806 | WP_011054802.1 | tail protein | - |
| SP119_RS05405 (SP119_1012) | - | 1038250..1038708 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| SP119_RS05410 (SP119_1013) | - | 1038681..1038998 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| SP119_RS05415 (SP119_1014) | - | 1039011..1039517 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| SP119_RS05420 (SP119_1015) | - | 1039529..1039939 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| SP119_RS05425 (SP119_1016) | - | 1039941..1040336 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| SP119_RS05430 (SP119_1017) | - | 1040333..1040644 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| SP119_RS05435 (SP119_1018) | - | 1040641..1040985 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| SP119_RS05440 (SP119_1019) | - | 1040999..1041292 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| SP119_RS05445 (SP119_1020) | - | 1041305..1042195 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| SP119_RS05450 (SP119_1021) | - | 1042214..1042783 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| SP119_RS10010 (SP119_1022) | - | 1042892..1043026 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| SP119_RS05455 (SP119_1023) | - | 1043028..1043297 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| SP119_RS05460 (SP119_1024) | - | 1043304..1044212 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| SP119_RS05465 (SP119_1025) | - | 1044181..1045506 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| SP119_RS05470 (SP119_1026) | - | 1045506..1046780 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| SP119_RS05475 (SP119_1027) | - | 1046770..1047150 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| SP119_RS05480 (SP119_1028) | - | 1047760..1048194 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SP119_RS05485 (SP119_1029) | - | 1048480..1048746 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| SP119_RS05490 (SP119_1030) | - | 1048743..1049267 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| SP119_RS05495 (SP119_1031) | - | 1049270..1049902 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SP119_RS05500 | - | 1049904..1050188 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| SP119_RS09780 (SP119_1032) | - | 1050185..1050355 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| SP119_RS05505 (SP119_1033) | - | 1050352..1050588 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| SP119_RS10035 | - | 1050588..1050833 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| SP119_RS05515 (SP119_1035) | - | 1050830..1051186 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| SP119_RS05520 (SP119_1036) | - | 1051183..1051623 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SP119_RS05525 | - | 1051623..1051826 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| SP119_RS05530 (SP119_1037) | ssb | 1051832..1052257 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SP119_RS05535 (SP119_1038) | - | 1052250..1052924 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| SP119_RS05540 (SP119_1039) | - | 1052925..1053407 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| SP119_RS05545 (SP119_1040) | - | 1053429..1053683 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| SP119_RS05550 (SP119_1041) | - | 1053664..1054017 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| SP119_RS05555 (SP119_1043) | - | 1054158..1054940 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| SP119_RS05560 (SP119_1044) | - | 1054927..1055757 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SP119_RS09920 | - | 1055771..1055959 (-) | 189 | Protein_1025 | XRE family transcriptional regulator | - |
| SP119_RS09925 | - | 1056193..1056432 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| SP119_RS05575 (SP119_1046) | - | 1056563..1056772 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| SP119_RS05580 (SP119_1047) | - | 1056882..1057082 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| SP119_RS05585 (SP119_1048) | - | 1057156..1057542 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| SP119_RS05590 (SP119_1049) | - | 1057531..1057740 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| SP119_RS05595 (SP119_1050) | - | 1057794..1058393 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| SP119_RS05600 (SP119_1051) | - | 1058423..1058581 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| SP119_RS05605 (SP119_1052) | - | 1058938..1059762 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| SP119_RS05610 (SP119_1053) | - | 1059798..1060691 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| SP119_RS05615 (SP119_1054) | - | 1060812..1061900 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| SP119_RS05620 (SP119_1056) | - | 1062263..1062883 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=1116145 SP119_RS05530 WP_011285575.1 1051832..1052257(-) (ssb) [Streptococcus pyogenes strain S119 isolate S119]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1116145 SP119_RS05530 WP_011285575.1 1051832..1052257(-) (ssb) [Streptococcus pyogenes strain S119 isolate S119]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |