Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | B6D67_RS05845 | Genome accession | NZ_LN831034 |
| Coordinates | 1088620..1089045 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8198 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1053366..1100631 | 1088620..1089045 | within | 0 |
Gene organization within MGE regions
Location: 1053366..1100631
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B6D67_RS05615 (ERS445054_01117) | pfkA | 1053366..1054379 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| B6D67_RS05620 (ERS445054_01118) | - | 1054459..1057569 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| B6D67_RS05625 (ERS445054_01119) | - | 1057754..1058125 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| B6D67_RS05630 (ERS445054_01120) | - | 1058125..1058823 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| B6D67_RS05635 (ERS445054_01121) | - | 1058833..1059618 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| B6D67_RS05640 (ERS445054_01122) | - | 1059745..1060359 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| B6D67_RS05650 (ERS445054_01124) | prx | 1060950..1061138 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| B6D67_RS05655 (ERS445054_01125) | speA | 1061359..1062114 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| B6D67_RS05660 (ERS445054_01126) | - | 1062236..1062895 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| B6D67_RS05665 (ERS445054_01127) | - | 1062895..1063116 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| B6D67_RS05670 (ERS445054_01128) | - | 1063126..1063899 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| B6D67_RS05675 (ERS445054_01129) | - | 1063910..1064512 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| B6D67_RS05680 (ERS445054_01130) | - | 1064524..1065288 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| B6D67_RS05685 (ERS445054_01131) | - | 1065290..1065622 (-) | 333 | WP_011285562.1 | phage holin | - |
| B6D67_RS05690 (ERS445054_01132) | - | 1065622..1065945 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| B6D67_RS10510 (ERS445054_01133) | - | 1065959..1066081 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| B6D67_RS05695 (ERS445054_01134) | - | 1066095..1066442 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| B6D67_RS05700 (ERS445054_01135) | - | 1066453..1068315 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| B6D67_RS05705 (ERS445054_01136) | - | 1068320..1071760 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| B6D67_RS05710 (ERS445054_01137) | - | 1071761..1073245 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| B6D67_RS05715 (ERS445054_01138) | - | 1073246..1075051 (-) | 1806 | WP_011054802.1 | tail protein | - |
| B6D67_RS05720 (ERS445054_01139) | - | 1075044..1075502 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| B6D67_RS05725 (ERS445054_01140) | - | 1075475..1075792 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| B6D67_RS05730 (ERS445054_01141) | - | 1075805..1076311 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| B6D67_RS05735 (ERS445054_01142) | - | 1076323..1076733 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| B6D67_RS05740 (ERS445054_01143) | - | 1076735..1077130 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| B6D67_RS05745 (ERS445054_01144) | - | 1077127..1077438 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| B6D67_RS05750 (ERS445054_01145) | - | 1077435..1077773 (-) | 339 | WP_029714010.1 | hypothetical protein | - |
| B6D67_RS05755 (ERS445054_01146) | - | 1077787..1078080 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| B6D67_RS05760 (ERS445054_01147) | - | 1078093..1078983 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| B6D67_RS05765 (ERS445054_01148) | - | 1079002..1079571 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| B6D67_RS10515 (ERS445054_01149) | - | 1079680..1079814 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| B6D67_RS05770 (ERS445054_01150) | - | 1079816..1080085 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| B6D67_RS05775 (ERS445054_01151) | - | 1080092..1081000 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| B6D67_RS05780 (ERS445054_01152) | - | 1080969..1082294 (-) | 1326 | WP_029714009.1 | phage portal protein | - |
| B6D67_RS05785 (ERS445054_01153) | - | 1082294..1083568 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| B6D67_RS05790 (ERS445054_01154) | - | 1083558..1083938 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| B6D67_RS05795 (ERS445054_01155) | - | 1084548..1084982 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B6D67_RS05800 (ERS445054_01156) | - | 1085268..1085534 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| B6D67_RS05805 (ERS445054_01157) | - | 1085531..1086055 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| B6D67_RS05810 (ERS445054_01158) | - | 1086058..1086690 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| B6D67_RS05815 (ERS445054_01159) | - | 1086692..1086976 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| B6D67_RS10260 (ERS445054_01160) | - | 1086973..1087143 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| B6D67_RS05820 (ERS445054_01161) | - | 1087140..1087376 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| B6D67_RS10545 (ERS445054_01162) | - | 1087376..1087621 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| B6D67_RS05830 (ERS445054_01163) | - | 1087618..1087974 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| B6D67_RS05835 (ERS445054_01164) | - | 1087971..1088411 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| B6D67_RS05840 | - | 1088411..1088614 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| B6D67_RS05845 (ERS445054_01165) | ssb | 1088620..1089045 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| B6D67_RS05850 (ERS445054_01166) | - | 1089038..1089712 (-) | 675 | WP_046735269.1 | ERF family protein | - |
| B6D67_RS05855 (ERS445054_01167) | - | 1089713..1090195 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| B6D67_RS05860 (ERS445054_01168) | - | 1090217..1090471 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| B6D67_RS05865 (ERS445054_01169) | - | 1090452..1090805 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| B6D67_RS05870 (ERS445054_01171) | - | 1090946..1091728 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| B6D67_RS05875 (ERS445054_01172) | - | 1091715..1092545 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| B6D67_RS05880 (ERS445054_01173) | - | 1092559..1092873 (-) | 315 | WP_023610888.1 | helix-turn-helix domain-containing protein | - |
| B6D67_RS10520 (ERS445054_01174) | - | 1092889..1093023 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| B6D67_RS05885 (ERS445054_01175) | - | 1093020..1093316 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| B6D67_RS05890 (ERS445054_01176) | - | 1093353..1093616 (-) | 264 | WP_029714276.1 | hypothetical protein | - |
| B6D67_RS05895 (ERS445054_01177) | - | 1093671..1094180 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| B6D67_RS05900 (ERS445054_01178) | - | 1094311..1094520 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| B6D67_RS05905 (ERS445054_01179) | - | 1094630..1094830 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| B6D67_RS05910 (ERS445054_01180) | - | 1094904..1095290 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| B6D67_RS05915 (ERS445054_01181) | - | 1095279..1095488 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| B6D67_RS05920 (ERS445054_01182) | - | 1095542..1096141 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| B6D67_RS05925 (ERS445054_01183) | - | 1096171..1096329 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| B6D67_RS05930 (ERS445054_01185) | - | 1096686..1097510 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| B6D67_RS05935 (ERS445054_01186) | - | 1097546..1098439 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| B6D67_RS05940 (ERS445054_01187) | - | 1098560..1099648 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| B6D67_RS05945 (ERS445054_01188) | - | 1100011..1100631 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=1114234 B6D67_RS05845 WP_011285575.1 1088620..1089045(-) (ssb) [Streptococcus pyogenes strain NCTC8198]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1114234 B6D67_RS05845 WP_011285575.1 1088620..1089045(-) (ssb) [Streptococcus pyogenes strain NCTC8198]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |