Detailed information NTG1085971

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACJWMC_RS09655
• Genome accession: NZ_CP177181
• Coordinates: 2053122..2053436 (-)
• Length: 104 a.a.
• NCBI ID: WP_037611125.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain MRD1919
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2048122..2058436

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACJWMC_RS09615	-	2048390..2049046 (-)	657	WP_002892031.1	CPBP family intramembrane glutamic endopeptidase	-
ACJWMC_RS09620	-	2049058..2049255 (-)	198	WP_037598528.1	helix-turn-helix transcriptional regulator	-
ACJWMC_RS09625	-	2049502..2050695 (-)	1194	WP_002892033.1	acetate kinase	-
ACJWMC_RS09630	comYH	2050752..2051708 (-)	957	WP_002885753.1	class I SAM-dependent methyltransferase	Machinery gene
ACJWMC_RS09635	comGG	2051753..2052070 (-)	318	WP_021144683.1	competence type IV pilus minor pilin ComGG	-
ACJWMC_RS09640	comYF	2052048..2052485 (-)	438	WP_002887014.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACJWMC_RS09645	comGE	2052472..2052702 (-)	231	WP_014635119.1	competence type IV pilus minor pilin ComGE	-
ACJWMC_RS09650	comYD	2052734..2053162 (-)	429	WP_260312930.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACJWMC_RS09655	comYC	2053122..2053436 (-)	315	WP_037611125.1	competence type IV pilus major pilin ComGC	Machinery gene
ACJWMC_RS09660	comYB	2053445..2054545 (-)	1101	WP_155115607.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACJWMC_RS09665	comYA	2054427..2055368 (-)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
ACJWMC_RS09670	-	2055448..2055810 (-)	363	WP_002885749.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11428.31 Da
• Isoelectric Point: 9.7150

>NTDB_id=1085971 ACJWMC_RS09655 WP_037611125.1 2053122..2053436(-) (comYC) [Streptococcus salivarius strain MRD1919]
MKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI
TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 315 bp

>NTDB_id=1085971 ACJWMC_RS09655 WP_037611125.1 2053122..2053436(-) (comYC) [Streptococcus salivarius strain MRD1919]
TTGAAAAAATTGAATGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT
CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG
TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC
ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	70.192	100	0.702
comYC	Streptococcus mutans UA159	70.192	100	0.702
comYC	Streptococcus gordonii str. Challis substr. CH1	64.762	100	0.654
comGC/cglC	Streptococcus mitis SK321	63.636	95.192	0.606
comGC/cglC	Streptococcus mitis NCTC 12261	59.406	97.115	0.577
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comGC/cglC	Streptococcus pneumoniae R6	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae Rx1	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae D39	59.596	95.192	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375