Detailed information NTG1085832

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACJVC4_RS09635
• Genome accession: NZ_CP177179
• Coordinates: 2054942..2055256 (-)
• Length: 104 a.a.
• NCBI ID: WP_037611125.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain MRD-NRLLH
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2049942..2060256

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACJVC4_RS09595	-	2050210..2050866 (-)	657	WP_002892031.1	CPBP family intramembrane glutamic endopeptidase	-
ACJVC4_RS09600	-	2050878..2051075 (-)	198	WP_037598528.1	helix-turn-helix transcriptional regulator	-
ACJVC4_RS09605	-	2051322..2052515 (-)	1194	WP_002892033.1	acetate kinase	-
ACJVC4_RS09610	comYH	2052572..2053528 (-)	957	WP_002885753.1	class I SAM-dependent methyltransferase	Machinery gene
ACJVC4_RS09615	comGG	2053573..2053890 (-)	318	WP_021144683.1	competence type IV pilus minor pilin ComGG	-
ACJVC4_RS09620	comYF	2053868..2054305 (-)	438	WP_002887014.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACJVC4_RS09625	comGE	2054292..2054522 (-)	231	WP_014635119.1	competence type IV pilus minor pilin ComGE	-
ACJVC4_RS09630	comYD	2054554..2054982 (-)	429	WP_260312930.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACJVC4_RS09635	comYC	2054942..2055256 (-)	315	WP_037611125.1	competence type IV pilus major pilin ComGC	Machinery gene
ACJVC4_RS09640	comYB	2055265..2056365 (-)	1101	WP_155115607.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACJVC4_RS09645	comYA	2056247..2057188 (-)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
ACJVC4_RS09650	-	2057268..2057630 (-)	363	WP_002885749.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11428.31 Da
• Isoelectric Point: 9.7150

>NTDB_id=1085832 ACJVC4_RS09635 WP_037611125.1 2054942..2055256(-) (comYC) [Streptococcus salivarius strain MRD-NRLLH]
MKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI
TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 315 bp

>NTDB_id=1085832 ACJVC4_RS09635 WP_037611125.1 2054942..2055256(-) (comYC) [Streptococcus salivarius strain MRD-NRLLH]
TTGAAAAAATTGAATGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT
CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG
TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC
ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	70.192	100	0.702
comYC	Streptococcus mutans UA159	70.192	100	0.702
comYC	Streptococcus gordonii str. Challis substr. CH1	64.762	100	0.654
comGC/cglC	Streptococcus mitis SK321	63.636	95.192	0.606
comGC/cglC	Streptococcus mitis NCTC 12261	59.406	97.115	0.577
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comGC/cglC	Streptococcus pneumoniae R6	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae Rx1	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae D39	59.596	95.192	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375