Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LRH_RS04030 | Genome accession | NZ_CP174514 |
| Coordinates | 833990..834427 (+) | Length | 145 a.a. |
| NCBI ID | WP_005686916.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus HN001 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 826724..867551 | 833990..834427 | within | 0 |
Gene organization within MGE regions
Location: 826724..867551
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRH_RS03970 (LRH_03970) | - | 826724..827851 (-) | 1128 | WP_005686887.1 | site-specific integrase | - |
| LRH_RS03975 (LRH_03975) | - | 828026..828703 (-) | 678 | WP_005686889.1 | hypothetical protein | - |
| LRH_RS03980 (LRH_03980) | - | 828760..829434 (-) | 675 | WP_005686890.1 | LexA family protein | - |
| LRH_RS03985 (LRH_03985) | - | 829596..829841 (+) | 246 | WP_005686894.1 | helix-turn-helix domain-containing protein | - |
| LRH_RS03990 (LRH_03990) | - | 829838..830563 (+) | 726 | WP_005686896.1 | phage regulatory protein | - |
| LRH_RS03995 (LRH_03995) | - | 830611..830967 (+) | 357 | WP_003572199.1 | DUF771 domain-containing protein | - |
| LRH_RS04000 (LRH_04000) | - | 831052..831204 (+) | 153 | WP_005686904.1 | hypothetical protein | - |
| LRH_RS04005 (LRH_04005) | - | 831209..831412 (+) | 204 | WP_005686906.1 | hypothetical protein | - |
| LRH_RS04010 (LRH_04010) | - | 831430..831921 (+) | 492 | WP_005686909.1 | siphovirus Gp157 family protein | - |
| LRH_RS04015 (LRH_04015) | - | 831932..832687 (+) | 756 | WP_005686911.1 | ERF family protein | - |
| LRH_RS04020 (LRH_04020) | - | 832690..833352 (+) | 663 | WP_048516655.1 | putative HNHc nuclease | - |
| LRH_RS04025 (LRH_04025) | - | 833366..833914 (+) | 549 | WP_005686914.1 | NUMOD4 domain-containing protein | - |
| LRH_RS04030 (LRH_04030) | ssb | 833990..834427 (+) | 438 | WP_005686916.1 | single-stranded DNA-binding protein | Machinery gene |
| LRH_RS04035 (LRH_04035) | - | 834444..835277 (+) | 834 | WP_005686918.1 | helix-turn-helix domain-containing protein | - |
| LRH_RS04040 (LRH_04040) | - | 835274..836536 (+) | 1263 | WP_005686920.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LRH_RS04045 (LRH_04045) | - | 836538..836882 (+) | 345 | WP_005686922.1 | hypothetical protein | - |
| LRH_RS04050 (LRH_04050) | - | 836895..837173 (+) | 279 | WP_005686924.1 | helix-turn-helix domain-containing protein | - |
| LRH_RS04055 (LRH_04055) | - | 837170..837619 (+) | 450 | WP_005686926.1 | hypothetical protein | - |
| LRH_RS04060 (LRH_04060) | - | 837622..838005 (+) | 384 | WP_005686928.1 | DUF1064 domain-containing protein | - |
| LRH_RS04065 (LRH_04065) | - | 838017..838127 (+) | 111 | WP_005686930.1 | hypothetical protein | - |
| LRH_RS04070 (LRH_04070) | - | 838219..838974 (+) | 756 | WP_005686931.1 | DNA-methyltransferase | - |
| LRH_RS04075 (LRH_04075) | - | 839059..839502 (+) | 444 | WP_373879533.1 | DUF1642 domain-containing protein | - |
| LRH_RS04080 (LRH_04080) | - | 839492..839863 (+) | 372 | WP_005686935.1 | hypothetical protein | - |
| LRH_RS04085 (LRH_04085) | - | 839860..840249 (+) | 390 | WP_005686937.1 | hypothetical protein | - |
| LRH_RS04090 (LRH_04090) | - | 840246..840434 (+) | 189 | WP_005686939.1 | hypothetical protein | - |
| LRH_RS04095 (LRH_04095) | - | 840500..840919 (+) | 420 | WP_005686941.1 | YopX family protein | - |
| LRH_RS04100 (LRH_04100) | - | 841349..841792 (+) | 444 | WP_005686946.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LRH_RS04105 (LRH_04105) | - | 842080..842940 (+) | 861 | WP_005686948.1 | hypothetical protein | - |
| LRH_RS04110 (LRH_04110) | - | 843481..844629 (+) | 1149 | WP_005686951.1 | GcrA family cell cycle regulator | - |
| LRH_RS04115 (LRH_04115) | - | 844642..845172 (+) | 531 | WP_005686953.1 | NUMOD4 domain-containing protein | - |
| LRH_RS04120 (LRH_04120) | - | 845176..845496 (+) | 321 | WP_005686955.1 | hypothetical protein | - |
| LRH_RS04125 (LRH_04125) | - | 845499..845822 (+) | 324 | WP_005686957.1 | hypothetical protein | - |
| LRH_RS04130 (LRH_04130) | - | 845840..846004 (+) | 165 | WP_005686959.1 | hypothetical protein | - |
| LRH_RS04135 (LRH_04135) | - | 846041..846835 (+) | 795 | WP_005686961.1 | HNH endonuclease | - |
| LRH_RS04140 (LRH_04140) | - | 847035..847490 (+) | 456 | WP_005686963.1 | P27 family phage terminase small subunit | - |
| LRH_RS04145 (LRH_04145) | - | 847512..849224 (+) | 1713 | WP_005686965.1 | terminase large subunit | - |
| LRH_RS04150 (LRH_04150) | - | 849236..849427 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| LRH_RS04155 (LRH_04155) | - | 849433..850686 (+) | 1254 | WP_005686969.1 | phage portal protein | - |
| LRH_RS04160 (LRH_04160) | - | 850640..851269 (+) | 630 | WP_015764348.1 | HK97 family phage prohead protease | - |
| LRH_RS04165 (LRH_04165) | - | 851311..852513 (+) | 1203 | WP_005686973.1 | phage major capsid protein | - |
| LRH_RS04170 (LRH_04170) | - | 852531..852770 (+) | 240 | WP_005686975.1 | Ig-like domain-containing protein | - |
| LRH_RS04175 (LRH_04175) | - | 852781..853140 (+) | 360 | WP_005686976.1 | head-tail connector protein | - |
| LRH_RS04180 (LRH_04180) | - | 853130..853459 (+) | 330 | WP_005686978.1 | head-tail adaptor protein | - |
| LRH_RS04185 (LRH_04185) | - | 853459..853845 (+) | 387 | WP_005686980.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LRH_RS04190 (LRH_04190) | - | 853845..854231 (+) | 387 | WP_005686982.1 | hypothetical protein | - |
| LRH_RS04195 (LRH_04195) | - | 854265..854885 (+) | 621 | WP_005686984.1 | major tail protein | - |
| LRH_RS04200 (LRH_04200) | - | 854942..855127 (+) | 186 | WP_005686987.1 | Ig domain-containing protein | - |
| LRH_RS04205 (LRH_04205) | gpG | 855198..855611 (+) | 414 | WP_003661382.1 | phage tail assembly chaperone G | - |
| LRH_RS04210 (LRH_04210) | - | 855734..860596 (+) | 4863 | WP_005686989.1 | phage tail tape measure protein | - |
| LRH_RS04215 (LRH_04215) | - | 860597..862519 (+) | 1923 | WP_005686991.1 | distal tail protein Dit | - |
| LRH_RS04220 (LRH_04220) | - | 862519..865026 (+) | 2508 | WP_005686993.1 | phage tail protein | - |
| LRH_RS04225 (LRH_04225) | - | 865036..865359 (+) | 324 | WP_005686996.1 | hypothetical protein | - |
| LRH_RS04230 (LRH_04230) | - | 865352..865483 (+) | 132 | WP_014569499.1 | XkdX family protein | - |
| LRH_RS04235 (LRH_04235) | - | 865513..865803 (+) | 291 | WP_005686998.1 | hypothetical protein | - |
| LRH_RS04240 (LRH_04240) | - | 865796..866242 (+) | 447 | WP_005687000.1 | phage holin | - |
| LRH_RS04245 (LRH_04245) | - | 866253..867551 (+) | 1299 | WP_005687002.1 | LysM peptidoglycan-binding domain-containing protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15964.61 Da Isoelectric Point: 5.1662
>NTDB_id=1077573 LRH_RS04030 WP_005686916.1 833990..834427(+) (ssb) [Lacticaseibacillus rhamnosus HN001]
MLNTVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAAIQGNSFANNGQPVDIRDDDLPF
MLNTVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAAIQGNSFANNGQPVDIRDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=1077573 LRH_RS04030 WP_005686916.1 833990..834427(+) (ssb) [Lacticaseibacillus rhamnosus HN001]
ATGTTAAACACAGTTGCTTTAACAGGTCGATTAACCAAAGATGTTGATCTTCGCTATACACAAAGCGGAACAGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAATCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
ATGTTAAACACAGTTGCTTTAACAGGTCGATTAACCAAAGATGTTGATCTTCGCTATACACAAAGCGGAACAGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAATCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.059 |
100 |
0.669 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
46.857 |
100 |
0.566 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
73.103 |
0.393 |
| ssb | Neisseria meningitidis MC58 |
32.37 |
100 |
0.386 |
| ssb | Neisseria gonorrhoeae MS11 |
32.37 |
100 |
0.386 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.241 |
100 |
0.372 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.552 |
100 |
0.366 |