Detailed information
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | ACIVIR_RS02005 | Genome accession | NZ_CP173225 |
| Coordinates | 371477..371956 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588874.1 | Uniprot ID | A0AA44S6A3 |
| Organism | Streptococcus pneumoniae strain 262 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 367983..428796 | 371477..371956 | within | 0 |
| IS/Tn | 370006..371253 | 371477..371956 | flank | 224 |
Gene organization within MGE regions
Location: 367983..428796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACIVIR_RS01995 | ftsH | 367983..369941 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| ACIVIR_RS02000 | - | 370006..371253 (-) | 1248 | WP_114880800.1 | ISL3 family transposase | - |
| ACIVIR_RS02005 | comX/comX2 | 371477..371956 (+) | 480 | WP_000588874.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| ACIVIR_RS02040 | - | 377383..378180 (-) | 798 | Protein_353 | transposase | - |
| ACIVIR_RS02045 | comW | 378446..378682 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| ACIVIR_RS02050 | - | 378913..380199 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| ACIVIR_RS02055 | - | 380441..381589 (-) | 1149 | WP_000876732.1 | site-specific integrase | - |
| ACIVIR_RS02060 | - | 381775..382698 (-) | 924 | WP_000122591.1 | exonuclease domain-containing protein | - |
| ACIVIR_RS02065 | - | 382711..383094 (-) | 384 | WP_001865140.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACIVIR_RS02070 | - | 383107..383472 (-) | 366 | WP_000492031.1 | helix-turn-helix domain-containing protein | - |
| ACIVIR_RS02075 | - | 383778..384260 (-) | 483 | WP_000842471.1 | hypothetical protein | - |
| ACIVIR_RS02080 | - | 384315..384518 (+) | 204 | WP_000032096.1 | hypothetical protein | - |
| ACIVIR_RS02085 | - | 384535..384732 (+) | 198 | WP_001057654.1 | hypothetical protein | - |
| ACIVIR_RS02090 | - | 384848..385507 (-) | 660 | WP_001865135.1 | hypothetical protein | - |
| ACIVIR_RS02095 | - | 385561..386277 (+) | 717 | WP_001865134.1 | ORF6C domain-containing protein | - |
| ACIVIR_RS02100 | - | 386290..386547 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| ACIVIR_RS02105 | - | 386633..386953 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| ACIVIR_RS02110 | - | 386969..387265 (+) | 297 | WP_001865133.1 | hypothetical protein | - |
| ACIVIR_RS02115 | - | 387258..388064 (+) | 807 | WP_054387342.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACIVIR_RS02120 | - | 388204..388974 (+) | 771 | WP_000228214.1 | ATP-binding protein | - |
| ACIVIR_RS02125 | - | 388989..389183 (+) | 195 | WP_000470305.1 | hypothetical protein | - |
| ACIVIR_RS02130 | - | 389183..389410 (+) | 228 | WP_050267377.1 | hypothetical protein | - |
| ACIVIR_RS02135 | - | 389537..389704 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| ACIVIR_RS02140 | - | 390032..390385 (+) | 354 | WP_001177094.1 | helix-turn-helix domain-containing protein | - |
| ACIVIR_RS02145 | - | 390367..390831 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| ACIVIR_RS02150 | - | 390940..391482 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| ACIVIR_RS02155 | - | 392023..392229 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| ACIVIR_RS02160 | - | 392366..392860 (+) | 495 | WP_054387340.1 | hypothetical protein | - |
| ACIVIR_RS02165 | - | 392853..394565 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| ACIVIR_RS02170 | - | 394574..395716 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| ACIVIR_RS02175 | - | 395763..396305 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| ACIVIR_RS02180 | - | 396320..397573 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| ACIVIR_RS02185 | - | 397599..397934 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| ACIVIR_RS02190 | - | 397931..398236 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| ACIVIR_RS02195 | - | 398236..398583 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| ACIVIR_RS02200 | - | 398570..398914 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| ACIVIR_RS02205 | - | 398928..399596 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| ACIVIR_RS02210 | - | 399598..400074 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| ACIVIR_RS02215 | - | 400261..402999 (+) | 2739 | WP_000852167.1 | phage tail tape measure protein | - |
| ACIVIR_RS02220 | - | 402996..403718 (+) | 723 | WP_050199190.1 | phage tail protein | - |
| ACIVIR_RS02225 | - | 403719..411680 (+) | 7962 | WP_114880801.1 | phage tail spike protein | - |
| ACIVIR_RS02230 | - | 411677..411793 (+) | 117 | WP_001063633.1 | hypothetical protein | - |
| ACIVIR_RS02235 | - | 411774..411977 (+) | 204 | WP_001091109.1 | hypothetical protein | - |
| ACIVIR_RS02240 | - | 411980..412330 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| ACIVIR_RS02245 | - | 412340..412756 (+) | 417 | WP_001165341.1 | phage holin family protein | - |
| ACIVIR_RS02250 | - | 412760..413092 (+) | 333 | WP_001186207.1 | phage holin | - |
| ACIVIR_RS02255 | lytA | 413096..414052 (+) | 957 | WP_000350489.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| ACIVIR_RS02260 | - | 414321..414500 (-) | 180 | WP_001233269.1 | hypothetical protein | - |
| ACIVIR_RS02265 | - | 414642..414791 (-) | 150 | WP_162489709.1 | hypothetical protein | - |
| ACIVIR_RS02270 | tadA | 415061..415528 (+) | 468 | WP_000291874.1 | tRNA adenosine(34) deaminase TadA | - |
| ACIVIR_RS02280 | - | 415715..416158 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| ACIVIR_RS02285 | - | 416160..416675 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| ACIVIR_RS02290 | radA | 416689..418050 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| ACIVIR_RS02295 | - | 418123..418620 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| ACIVIR_RS02300 | - | 418645..419459 (+) | 815 | Protein_404 | PrsW family intramembrane metalloprotease | - |
| ACIVIR_RS02305 | - | 419604..420572 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| ACIVIR_RS02310 | - | 420690..421635 (+) | 946 | Protein_406 | Rpn family recombination-promoting nuclease/putative transposase | - |
| ACIVIR_RS02315 | polA | 422138..424771 (+) | 2634 | WP_050279195.1 | DNA polymerase I | - |
| ACIVIR_RS02320 | - | 424856..425293 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| ACIVIR_RS02325 | - | 425334..425672 (+) | 339 | WP_061849647.1 | hypothetical protein | - |
| ACIVIR_RS02330 | - | 425701..426711 (-) | 1011 | WP_000009175.1 | YeiH family protein | - |
| ACIVIR_RS02335 | - | 426860..428029 (+) | 1170 | WP_000366348.1 | pyridoxal phosphate-dependent aminotransferase | - |
| ACIVIR_RS02340 | recO | 428026..428796 (+) | 771 | WP_050220959.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19845.50 Da Isoelectric Point: 7.3795
>NTDB_id=1070794 ACIVIR_RS02005 WP_000588874.1 371477..371956(+) (comX/comX2) [Streptococcus pneumoniae strain 262]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=1070794 ACIVIR_RS02005 WP_000588874.1 371477..371956(+) (comX/comX2) [Streptococcus pneumoniae strain 262]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.