Detailed information
Bioinformatically predicted
Overview
| Name | comX/comX2 | Type | Regulator |
| Locus tag | AAA982_RS00070 | Genome accession | NZ_AP028601 |
| Coordinates | 14254..14733 (+) | Length | 159 a.a. |
| NCBI ID | WP_000588864.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PF1 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..89765 | 14254..14733 | within | 0 |
Gene organization within MGE regions
Location: 12174..89765
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA982_RS00065 (TKY113292_00130) | ftsH | 12174..14132 (+) | 1959 | WP_130894422.1 | ATP-dependent zinc metalloprotease FtsH | - |
| AAA982_RS00070 (TKY113292_00140) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588864.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| AAA982_RS00105 (TKY113292_00150) | - | 20224..20620 (+) | 397 | Protein_14 | IS630 family transposase | - |
| AAA982_RS00110 | - | 20749..21546 (-) | 798 | Protein_15 | transposase | - |
| AAA982_RS00115 (TKY113292_00170) | comW | 21812..22048 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| AAA982_RS00120 (TKY113292_00180) | - | 22279..23565 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| AAA982_RS00125 (TKY113292_00190) | - | 23829..24977 (-) | 1149 | WP_000876727.1 | site-specific integrase | - |
| AAA982_RS00130 (TKY113292_00200) | - | 25148..25948 (-) | 801 | WP_000539947.1 | HIRAN domain-containing protein | - |
| AAA982_RS00135 (TKY113292_00210) | - | 26075..26830 (-) | 756 | WP_000069476.1 | XRE family transcriptional regulator | - |
| AAA982_RS00140 (TKY113292_00220) | - | 27004..27210 (+) | 207 | WP_001171134.1 | helix-turn-helix transcriptional regulator | - |
| AAA982_RS00145 (TKY113292_00250) | - | 27518..28195 (-) | 678 | WP_000289447.1 | DUF4145 domain-containing protein | - |
| AAA982_RS00150 (TKY113292_00260) | - | 28250..28963 (+) | 714 | WP_001002349.1 | ORF6C domain-containing protein | - |
| AAA982_RS00155 (TKY113292_00270) | - | 28976..29233 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| AAA982_RS00160 (TKY113292_00280) | - | 29319..29639 (+) | 321 | WP_000462823.1 | hypothetical protein | - |
| AAA982_RS00165 (TKY113292_00290) | - | 29655..29948 (+) | 294 | WP_000391814.1 | hypothetical protein | - |
| AAA982_RS00170 (TKY113292_00300) | - | 29941..30768 (+) | 828 | WP_001289767.1 | phage replisome organizer N-terminal domain-containing protein | - |
| AAA982_RS00175 (TKY113292_00320) | - | 30908..31678 (+) | 771 | WP_000228218.1 | ATP-binding protein | - |
| AAA982_RS00180 (TKY113292_00330) | - | 31693..31887 (+) | 195 | WP_000470303.1 | hypothetical protein | - |
| AAA982_RS00185 (TKY113292_00340) | - | 31887..32114 (+) | 228 | WP_000891969.1 | hypothetical protein | - |
| AAA982_RS00190 (TKY113292_00350) | - | 32241..32405 (+) | 165 | WP_000233201.1 | hypothetical protein | - |
| AAA982_RS00195 (TKY113292_00360) | - | 32395..32604 (+) | 210 | WP_001105098.1 | hypothetical protein | - |
| AAA982_RS00200 (TKY113292_00370) | - | 32576..32893 (+) | 318 | WP_000969666.1 | hypothetical protein | - |
| AAA982_RS00205 | - | 32895..33323 (+) | 429 | Protein_34 | DUF1642 domain-containing protein | - |
| AAA982_RS00210 | - | 33327..33590 (+) | 264 | WP_001859446.1 | hypothetical protein | - |
| AAA982_RS00215 | - | 33663..33740 (+) | 78 | Protein_36 | DNA-binding protein | - |
| AAA982_RS00220 (TKY113292_00390) | - | 33828..34181 (+) | 354 | WP_050295058.1 | helix-turn-helix transcriptional regulator | - |
| AAA982_RS00225 (TKY113292_00400) | - | 34163..34627 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| AAA982_RS00230 (TKY113292_00410) | - | 34736..35278 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| AAA982_RS00235 (TKY113292_00430) | - | 35819..36025 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| AAA982_RS00240 (TKY113292_00440) | - | 36162..36647 (+) | 486 | WP_000601030.1 | hypothetical protein | - |
| AAA982_RS00245 (TKY113292_00450) | - | 36640..38352 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| AAA982_RS00250 (TKY113292_00460) | - | 38361..39503 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| AAA982_RS00255 (TKY113292_00470) | - | 39550..40092 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| AAA982_RS00260 (TKY113292_00480) | - | 40107..41360 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| AAA982_RS00265 (TKY113292_00490) | - | 41386..41721 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| AAA982_RS00270 (TKY113292_00500) | - | 41718..42023 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| AAA982_RS00275 (TKY113292_00510) | - | 42023..42370 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| AAA982_RS00280 (TKY113292_00520) | - | 42357..42701 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| AAA982_RS00285 (TKY113292_00530) | - | 42715..43383 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| AAA982_RS00290 (TKY113292_00540) | - | 43385..43861 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| AAA982_RS00295 (TKY113292_00550) | - | 44048..46786 (+) | 2739 | WP_000852166.1 | phage tail tape measure protein | - |
| AAA982_RS00300 (TKY113292_00560) | - | 46783..47505 (+) | 723 | WP_000161552.1 | phage tail protein | - |
| AAA982_RS00305 (TKY113292_00570) | - | 47506..56613 (+) | 9108 | WP_338168294.1 | phage tail spike protein | - |
| AAA982_RS00310 | - | 56610..56726 (+) | 117 | WP_001063632.1 | hypothetical protein | - |
| AAA982_RS00315 (TKY113292_00580) | - | 56707..56910 (+) | 204 | WP_001091109.1 | hypothetical protein | - |
| AAA982_RS00320 (TKY113292_00590) | - | 56913..57263 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| AAA982_RS00325 (TKY113292_00600) | - | 57273..57689 (+) | 417 | WP_001165341.1 | phage holin family protein | - |
| AAA982_RS00330 (TKY113292_00610) | - | 57693..58025 (+) | 333 | WP_001186206.1 | phage holin | - |
| AAA982_RS00335 (TKY113292_00620) | - | 58029..58985 (+) | 957 | WP_000350503.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| AAA982_RS00340 (TKY113292_00630) | - | 59123..59302 (-) | 180 | WP_023937752.1 | hypothetical protein | - |
| AAA982_RS00345 (TKY113292_00640) | - | 59444..59593 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| AAA982_RS00350 (TKY113292_00650) | tadA | 59874..60341 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| AAA982_RS00360 (TKY113292_00660) | - | 60528..60971 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| AAA982_RS00365 (TKY113292_00670) | - | 60973..61488 (+) | 516 | WP_001823418.1 | histidine phosphatase family protein | - |
| AAA982_RS00370 (TKY113292_00680) | radA | 61502..62863 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| AAA982_RS00375 (TKY113292_00690) | - | 62936..63433 (+) | 498 | WP_001809420.1 | carbonic anhydrase | - |
| AAA982_RS00380 (TKY113292_00700) | - | 63458..64273 (+) | 816 | WP_317649201.1 | PrsW family glutamic-type intramembrane protease | - |
| AAA982_RS00385 (TKY113292_00710) | - | 64418..65386 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| AAA982_RS00390 | - | 65504..66449 (+) | 946 | Protein_70 | Rpn family recombination-promoting nuclease/putative transposase | - |
| AAA982_RS00395 (TKY113292_00740) | polA | 66952..69585 (+) | 2634 | WP_001854139.1 | DNA polymerase I | - |
| AAA982_RS00400 (TKY113292_00750) | - | 69670..70107 (+) | 438 | WP_050198148.1 | CoA-binding protein | - |
| AAA982_RS00405 | - | 70148..70318 (+) | 171 | WP_041852864.1 | hypothetical protein | - |
| AAA982_RS00410 (TKY113292_00760) | - | 70337..71347 (-) | 1011 | WP_050204489.1 | YeiH family protein | - |
| AAA982_RS00415 (TKY113292_00770) | - | 71496..72665 (+) | 1170 | WP_338168295.1 | pyridoxal phosphate-dependent aminotransferase | - |
| AAA982_RS00420 (TKY113292_00780) | recO | 72662..73432 (+) | 771 | WP_000616162.1 | DNA repair protein RecO | - |
| AAA982_RS00425 (TKY113292_00790) | plsX | 73429..74421 (+) | 993 | WP_050311686.1 | phosphate acyltransferase PlsX | - |
| AAA982_RS00430 (TKY113292_00800) | - | 74427..74660 (+) | 234 | WP_000659556.1 | acyl carrier protein | - |
| AAA982_RS00435 | - | 74706..74997 (+) | 292 | Protein_79 | IS5/IS1182 family transposase | - |
| AAA982_RS00440 | blpU | 75200..75430 (+) | 231 | Protein_80 | bacteriocin-like peptide BlpU | - |
| AAA982_RS00445 (TKY113292_00810) | - | 75433..75558 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| AAA982_RS00450 (TKY113292_00820) | comA | 76145..78298 (+) | 2154 | WP_338168296.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| AAA982_RS00455 (TKY113292_00830) | comB | 78311..79660 (+) | 1350 | WP_338168297.1 | competence pheromone export protein ComB | Regulator |
| AAA982_RS00460 (TKY113292_00840) | purC | 79830..80537 (+) | 708 | WP_000043300.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| AAA982_RS00465 | - | 80548..80682 (+) | 135 | WP_000429436.1 | hypothetical protein | - |
| AAA982_RS00470 (TKY113292_00850) | - | 80739..84464 (+) | 3726 | WP_338168298.1 | phosphoribosylformylglycinamidine synthase | - |
| AAA982_RS00475 (TKY113292_00860) | purF | 84557..85999 (+) | 1443 | WP_000220627.1 | amidophosphoribosyltransferase | - |
| AAA982_RS00480 (TKY113292_00870) | purM | 86036..87058 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| AAA982_RS00485 (TKY113292_00880) | purN | 87055..87600 (+) | 546 | WP_000717501.1 | phosphoribosylglycinamide formyltransferase | - |
| AAA982_RS00490 (TKY113292_00890) | - | 87684..88193 (+) | 510 | WP_050218630.1 | VanZ family protein | - |
| AAA982_RS00495 (TKY113292_00900) | purH | 88218..89765 (+) | 1548 | WP_000167085.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19845.46 Da Isoelectric Point: 7.3797
>NTDB_id=105783 AAA982_RS00070 WP_000588864.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain PF1]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRR
YDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
Nucleotide
Download Length: 480 bp
>NTDB_id=105783 AAA982_RS00070 WP_000588864.1 14254..14733(+) (comX/comX2) [Streptococcus pneumoniae strain PF1]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGCAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGCAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGAGAGATCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.