Detailed information NTG1039956

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: ACCQ10_RS15895
• Genome accession: NZ_CP167862
• Coordinates: 3740661..3741083 (-)
• Length: 140 a.a.
• NCBI ID: WP_323475831.1
• Uniprot ID: -
• Organism: Xanthomonas sp. NCPPB 1325
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3731176..3744196	3740661..3741083	within	0

Gene organization within MGE regions

Location: 3731176..3744196

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACCQ10_RS15860 (ACCQ10_15860)	sucD	3732202..3733077 (-)	876	WP_005921370.1	succinate--CoA ligase subunit alpha	-
ACCQ10_RS15865 (ACCQ10_15865)	sucC	3733102..3734271 (-)	1170	WP_039405518.1	ADP-forming succinate--CoA ligase subunit beta	-
ACCQ10_RS15870 (ACCQ10_15870)	-	3734503..3736116 (+)	1614	WP_039405515.1	PAS domain-containing sensor histidine kinase	-
ACCQ10_RS15875 (ACCQ10_15875)	-	3736202..3736381 (+)	180	Protein_3109	hypothetical protein	-
ACCQ10_RS15880 (ACCQ10_15880)	pilR	3736665..3738059 (+)	1395	WP_372361233.1	sigma-54-dependent transcriptional regulator	Regulator
ACCQ10_RS15885 (ACCQ10_15885)	pilB	3738235..3739941 (-)	1707	WP_372363144.1	type IV-A pilus assembly ATPase PilB	Machinery gene
ACCQ10_RS15890 (ACCQ10_15890)	comP	3740115..3740528 (-)	414	WP_372361234.1	pilin	Machinery gene
ACCQ10_RS15895 (ACCQ10_15895)	comP	3740661..3741083 (-)	423	WP_323475831.1	pilin	Machinery gene
ACCQ10_RS15900 (ACCQ10_15900)	pilC	3741409..3742671 (+)	1263	WP_372361235.1	type II secretion system F family protein	Machinery gene
ACCQ10_RS15905 (ACCQ10_15905)	-	3742678..3743541 (+)	864	WP_372361236.1	A24 family peptidase	-
ACCQ10_RS15910 (ACCQ10_15910)	coaE	3743555..3744196 (+)	642	WP_372361237.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 140 a.a.
• Molecular weight: 13878.97 Da
• Isoelectric Point: 8.1053

>NTDB_id=1039956 ACCQ10_RS15895 WP_323475831.1 3740661..3741083(-) (comP) [Xanthomonas sp. NCPPB 1325]
MNKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRARVSEAAVLASGAKTTVAENIANNGGTIAAGACLGVDTTAPATT
NVASVTCGANSGAIAITTTAKAGAVTLTFTPQPAAGIAGTKWTCVATGGKAAYYPAECRS

Nucleotide

• Length: 423 bp

>NTDB_id=1039956 ACCQ10_RS15895 WP_323475831.1 3740661..3741083(-) (comP) [Xanthomonas sp. NCPPB 1325]
ATGAACAAGCAACAAGGTTTTACCCTTATTGAATTGATGATCGTTGTGGCGATCATTGCTATTCTGGCAGCTATCGCTTT
GCCTGCATATCAAGACTATACGATCCGCGCACGCGTCTCTGAGGCTGCCGTGCTTGCTTCGGGTGCTAAAACTACCGTTG
CTGAGAACATCGCAAATAACGGCGGAACAATAGCTGCCGGCGCATGTCTTGGCGTCGATACCACCGCGCCAGCAACCACT
AATGTCGCTAGCGTTACCTGTGGCGCCAACAGCGGGGCGATTGCAATTACCACGACTGCTAAGGCCGGTGCAGTTACCTT
GACCTTCACTCCGCAGCCTGCTGCCGGTATTGCTGGTACTAAGTGGACCTGTGTTGCGACCGGAGGTAAGGCGGCTTACT
ATCCGGCTGAATGCCGTAGTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (36-139)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Acinetobacter baylyi ADP1	53.691	100	0.571
pilA2	Legionella pneumophila str. Paris	56.115	99.286	0.557
pilA2	Legionella pneumophila strain ERS1305867	55.396	99.286	0.55
pilA	Ralstonia pseudosolanacearum GMI1000	45.238	100	0.543
pilA/pilA1	Eikenella corrodens VA1	40.789	100	0.443
pilA	Vibrio parahaemolyticus RIMD 2210633	40.441	97.143	0.393
pilA/pilAI	Pseudomonas stutzeri DSM 10701	36.486	100	0.386
pilA	Acinetobacter baumannii strain A118	38.806	95.714	0.371