Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACB339_RS06615 | Genome accession | NZ_CP167023 |
| Coordinates | 1263197..1263616 (-) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain Isolate 3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1230394..1271914 | 1263197..1263616 | within | 0 |
Gene organization within MGE regions
Location: 1230394..1271914
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB339_RS06385 (ACB339_06380) | prx | 1230394..1230576 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| ACB339_RS06390 (ACB339_06385) | - | 1230922..1231497 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| ACB339_RS06395 (ACB339_06390) | spek | 1231974..1232753 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| ACB339_RS06400 (ACB339_06395) | - | 1233057..1233923 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| ACB339_RS06405 (ACB339_06400) | - | 1233911..1234435 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ACB339_RS06410 (ACB339_06405) | - | 1234575..1235777 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| ACB339_RS06415 (ACB339_06410) | - | 1235888..1236073 (-) | 186 | WP_011054731.1 | holin | - |
| ACB339_RS06420 (ACB339_06415) | - | 1236070..1236366 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| ACB339_RS06425 (ACB339_06420) | - | 1236377..1236988 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| ACB339_RS06430 (ACB339_06425) | - | 1236991..1237422 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| ACB339_RS06435 (ACB339_06430) | - | 1237434..1239324 (-) | 1891 | Protein_1224 | gp58-like family protein | - |
| ACB339_RS06440 (ACB339_06435) | hylP | 1239339..1240352 (-) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| ACB339_RS06445 (ACB339_06440) | - | 1240349..1242493 (-) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| ACB339_RS06450 (ACB339_06445) | - | 1242490..1243206 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ACB339_RS06455 (ACB339_06450) | - | 1243203..1246463 (-) | 3261 | WP_011054738.1 | tape measure protein | - |
| ACB339_RS06460 (ACB339_06455) | - | 1246453..1247034 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| ACB339_RS06465 (ACB339_06460) | - | 1247038..1247472 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| ACB339_RS06470 (ACB339_06465) | - | 1247511..1247996 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ACB339_RS06475 (ACB339_06470) | - | 1247996..1248394 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| ACB339_RS06480 (ACB339_06475) | - | 1248391..1248747 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| ACB339_RS06485 (ACB339_06480) | - | 1248747..1249079 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| ACB339_RS06490 (ACB339_06485) | - | 1249069..1249485 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| ACB339_RS06495 (ACB339_06490) | - | 1249539..1250357 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ACB339_RS06500 (ACB339_06495) | - | 1250361..1250975 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| ACB339_RS06505 (ACB339_06500) | - | 1251101..1251367 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| ACB339_RS06510 (ACB339_06505) | - | 1251429..1251668 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| ACB339_RS06515 (ACB339_06510) | - | 1251640..1253118 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ACB339_RS06520 (ACB339_06515) | - | 1253123..1254625 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| ACB339_RS06525 (ACB339_06520) | - | 1254639..1255930 (-) | 1292 | Protein_1242 | PBSX family phage terminase large subunit | - |
| ACB339_RS06530 (ACB339_06525) | - | 1255933..1256406 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| ACB339_RS06535 (ACB339_06530) | - | 1256457..1256834 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ACB339_RS06540 (ACB339_06535) | - | 1256895..1257371 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| ACB339_RS06545 (ACB339_06540) | - | 1257287..1257964 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ACB339_RS06550 (ACB339_06545) | - | 1257943..1258461 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ACB339_RS06555 (ACB339_06550) | - | 1258542..1258799 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| ACB339_RS06560 (ACB339_06555) | - | 1259438..1259878 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB339_RS06565 (ACB339_06560) | - | 1260152..1260322 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| ACB339_RS06570 (ACB339_06565) | - | 1260319..1260825 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| ACB339_RS06575 (ACB339_06570) | - | 1260822..1260992 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| ACB339_RS06580 (ACB339_06575) | - | 1260989..1261393 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| ACB339_RS06585 (ACB339_06580) | - | 1261403..1261672 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| ACB339_RS06590 (ACB339_06585) | - | 1261669..1261953 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| ACB339_RS06595 (ACB339_06590) | - | 1261947..1262198 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| ACB339_RS06600 (ACB339_06595) | - | 1262195..1262551 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| ACB339_RS06605 (ACB339_06600) | - | 1262548..1262988 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB339_RS06610 (ACB339_06605) | - | 1262988..1263191 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB339_RS06615 (ACB339_06610) | ssbA | 1263197..1263616 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB339_RS06620 (ACB339_06615) | - | 1263609..1264283 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| ACB339_RS06625 (ACB339_06620) | - | 1264284..1264766 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ACB339_RS06630 (ACB339_06625) | - | 1264788..1265042 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| ACB339_RS06635 (ACB339_06630) | - | 1265053..1265193 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| ACB339_RS06640 (ACB339_06635) | - | 1265190..1265424 (-) | 235 | Protein_1265 | hypothetical protein | - |
| ACB339_RS06645 (ACB339_06640) | - | 1265405..1265818 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| ACB339_RS06650 (ACB339_06645) | - | 1265940..1266197 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| ACB339_RS06655 (ACB339_06650) | - | 1266291..1266476 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| ACB339_RS06660 (ACB339_06655) | - | 1266505..1266762 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| ACB339_RS06665 (ACB339_06660) | - | 1267008..1267175 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| ACB339_RS06670 (ACB339_06665) | - | 1267251..1267451 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| ACB339_RS06675 (ACB339_06670) | - | 1267448..1267597 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| ACB339_RS06680 (ACB339_06675) | - | 1267630..1268358 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB339_RS06685 (ACB339_06680) | - | 1268369..1268560 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| ACB339_RS06690 (ACB339_06685) | - | 1269356..1269715 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| ACB339_RS06695 (ACB339_06690) | - | 1269729..1270109 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB339_RS06700 (ACB339_06695) | - | 1270120..1270641 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| ACB339_RS06705 (ACB339_06700) | - | 1270817..1271914 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=1038035 ACB339_RS06615 WP_011054759.1 1263197..1263616(-) (ssbA) [Streptococcus pyogenes strain Isolate 3]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=1038035 ACB339_RS06615 WP_011054759.1 1263197..1263616(-) (ssbA) [Streptococcus pyogenes strain Isolate 3]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |