Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACB329_RS05275 | Genome accession | NZ_CP167003 |
| Coordinates | 1034800..1035225 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 29 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999541..1045851 | 1034800..1035225 | within | 0 |
Gene organization within MGE regions
Location: 999541..1045851
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB329_RS05030 (ACB329_05035) | pfkA | 999541..1000554 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB329_RS05035 (ACB329_05040) | - | 1000634..1003744 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB329_RS05040 (ACB329_05045) | - | 1003929..1004300 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB329_RS05045 (ACB329_05050) | - | 1004300..1004998 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB329_RS05050 (ACB329_05055) | - | 1005008..1005793 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB329_RS05055 (ACB329_05060) | - | 1005920..1006534 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB329_RS05065 (ACB329_05070) | prx | 1007125..1007313 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB329_RS05070 (ACB329_05075) | speA | 1007533..1008288 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB329_RS05075 (ACB329_05080) | - | 1008410..1009069 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB329_RS05080 (ACB329_05085) | - | 1009069..1009290 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB329_RS05085 (ACB329_05090) | - | 1009300..1010073 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB329_RS05090 (ACB329_05095) | - | 1010084..1010686 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB329_RS05095 (ACB329_05100) | - | 1010698..1011462 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB329_RS05100 (ACB329_05105) | - | 1011464..1011796 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB329_RS05105 (ACB329_05110) | - | 1011796..1012119 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB329_RS05110 (ACB329_05115) | - | 1012133..1012255 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB329_RS05115 (ACB329_05120) | - | 1012269..1012616 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB329_RS05120 (ACB329_05125) | - | 1012627..1014489 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB329_RS05125 (ACB329_05130) | - | 1014494..1017934 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB329_RS05130 (ACB329_05135) | - | 1017935..1019419 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB329_RS05135 (ACB329_05140) | - | 1019420..1021225 (-) | 1806 | WP_371399073.1 | phage tail protein | - |
| ACB329_RS05140 (ACB329_05145) | - | 1021218..1021676 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB329_RS05145 (ACB329_05150) | - | 1021649..1021966 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB329_RS05150 (ACB329_05155) | - | 1021979..1022485 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB329_RS05155 (ACB329_05160) | - | 1022497..1022907 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB329_RS05160 (ACB329_05165) | - | 1022909..1023304 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB329_RS05165 (ACB329_05170) | - | 1023301..1023612 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB329_RS05170 (ACB329_05175) | - | 1023609..1023953 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB329_RS05175 (ACB329_05180) | - | 1023967..1024260 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB329_RS05180 (ACB329_05185) | - | 1024273..1025163 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB329_RS05185 (ACB329_05190) | - | 1025182..1025751 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB329_RS05190 (ACB329_05195) | - | 1025860..1025994 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB329_RS05195 (ACB329_05200) | - | 1025996..1026265 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB329_RS05200 (ACB329_05205) | - | 1026272..1027180 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB329_RS05205 (ACB329_05210) | - | 1027149..1028474 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB329_RS05210 (ACB329_05215) | - | 1028474..1029748 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB329_RS05215 (ACB329_05220) | - | 1029738..1030118 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB329_RS05220 (ACB329_05225) | - | 1030728..1031162 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB329_RS05225 (ACB329_05230) | - | 1031448..1031714 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB329_RS05230 (ACB329_05235) | - | 1031711..1032235 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB329_RS05235 (ACB329_05240) | - | 1032238..1032870 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB329_RS05240 (ACB329_05245) | - | 1032872..1033156 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB329_RS05245 (ACB329_05250) | - | 1033153..1033323 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB329_RS05250 (ACB329_05255) | - | 1033320..1033556 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB329_RS05255 (ACB329_05260) | - | 1033556..1033801 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB329_RS05260 (ACB329_05265) | - | 1033798..1034154 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB329_RS05265 (ACB329_05270) | - | 1034151..1034591 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB329_RS05270 (ACB329_05275) | - | 1034591..1034794 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB329_RS05275 (ACB329_05280) | ssb | 1034800..1035225 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB329_RS05280 (ACB329_05285) | - | 1035218..1035892 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB329_RS05285 (ACB329_05290) | - | 1035893..1036375 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB329_RS05290 (ACB329_05295) | - | 1036397..1036651 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB329_RS05295 (ACB329_05300) | - | 1036632..1036985 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB329_RS05300 (ACB329_05305) | - | 1037126..1037908 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB329_RS05305 (ACB329_05310) | - | 1037895..1038725 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB329_RS05310 (ACB329_05315) | - | 1038739..1038927 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| ACB329_RS05315 (ACB329_05320) | - | 1039161..1039400 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB329_RS05320 (ACB329_05325) | - | 1039531..1039740 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB329_RS05325 (ACB329_05330) | - | 1039850..1040050 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB329_RS05330 (ACB329_05335) | - | 1040124..1040510 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB329_RS05335 (ACB329_05340) | - | 1040499..1040708 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB329_RS05340 (ACB329_05345) | - | 1040762..1041361 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB329_RS05345 (ACB329_05350) | - | 1041391..1041549 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB329_RS05350 (ACB329_05355) | - | 1041906..1042730 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB329_RS05355 (ACB329_05360) | - | 1042766..1043659 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB329_RS05360 (ACB329_05365) | - | 1043780..1044868 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB329_RS05365 (ACB329_05370) | - | 1045231..1045851 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=1036980 ACB329_RS05275 WP_011285575.1 1034800..1035225(-) (ssb) [Streptococcus pyogenes strain Isolate 29]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1036980 ACB329_RS05275 WP_011285575.1 1034800..1035225(-) (ssb) [Streptococcus pyogenes strain Isolate 29]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |