Detailed information
Overview
| Name | comE/blpR | Type | Regulator |
| Locus tag | AB1F71_RS08870 | Genome accession | NZ_CP160386 |
| Coordinates | 1795692..1796444 (-) | Length | 250 a.a. |
| NCBI ID | WP_002262114.1 | Uniprot ID | Q8DS93 |
| Organism | Streptococcus mutans strain UA159 ykuR deletion | ||
| Function | activate transcription of early competence genes; regulation of comX expression (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1740347..1819739 | 1795692..1796444 | within | 0 |
Gene organization within MGE regions
Location: 1740347..1819739
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB1F71_RS08585 (AB1F71_08585) | - | 1740478..1741917 (+) | 1440 | WP_002262658.1 | sucrose-6-phosphate hydrolase | - |
| AB1F71_RS08590 (AB1F71_08590) | - | 1741920..1742882 (+) | 963 | WP_002262659.1 | LacI family DNA-binding transcriptional regulator | - |
| AB1F71_RS08595 (AB1F71_08595) | nusB | 1743076..1743504 (-) | 429 | WP_002262660.1 | transcription antitermination factor NusB | - |
| AB1F71_RS08600 (AB1F71_08600) | - | 1743497..1743886 (-) | 390 | WP_002262661.1 | Asp23/Gls24 family envelope stress response protein | - |
| AB1F71_RS08605 (AB1F71_08605) | efp | 1743929..1744489 (-) | 561 | WP_002262662.1 | elongation factor P | - |
| AB1F71_RS08610 (AB1F71_08610) | - | 1744629..1745333 (+) | 705 | WP_002262663.1 | ion transporter | - |
| AB1F71_RS08615 (AB1F71_08615) | - | 1745381..1745833 (-) | 453 | WP_002262664.1 | deaminase | - |
| AB1F71_RS08620 (AB1F71_08620) | - | 1746003..1747067 (-) | 1065 | WP_002262665.1 | Xaa-Pro peptidase family protein | - |
| AB1F71_RS08625 (AB1F71_08625) | uvrA | 1747057..1749888 (-) | 2832 | WP_002262666.1 | excinuclease ABC subunit UvrA | - |
| AB1F71_RS08630 (AB1F71_08630) | - | 1749938..1750159 (+) | 222 | WP_019313410.1 | hypothetical protein | - |
| AB1F71_RS08635 (AB1F71_08635) | - | 1750559..1751503 (+) | 945 | WP_002262667.1 | magnesium transporter CorA family protein | - |
| AB1F71_RS08640 (AB1F71_08640) | - | 1751785..1752447 (+) | 663 | WP_002262668.1 | DUF1129 domain-containing protein | - |
| AB1F71_RS08645 (AB1F71_08645) | hdrR | 1752586..1752942 (+) | 357 | WP_002262669.1 | LytTR family transcriptional regulator HdrR | Regulator |
| AB1F71_RS08650 (AB1F71_08650) | hdrM | 1752939..1753625 (+) | 687 | WP_002262670.1 | hdrR negative regulator HdrM | Regulator |
| AB1F71_RS08655 (AB1F71_08655) | - | 1753633..1754352 (-) | 720 | WP_002262671.1 | TraX family protein | - |
| AB1F71_RS08660 (AB1F71_08660) | rpsR | 1754671..1754910 (-) | 240 | WP_000068664.1 | 30S ribosomal protein S18 | - |
| AB1F71_RS08665 (AB1F71_08665) | ssbA | 1754939..1755433 (-) | 495 | WP_002261867.1 | single-stranded DNA-binding protein | Machinery gene |
| AB1F71_RS08670 (AB1F71_08670) | rpsF | 1755451..1755741 (-) | 291 | WP_002261866.1 | 30S ribosomal protein S6 | - |
| AB1F71_RS08675 (AB1F71_08675) | - | 1755897..1756142 (-) | 246 | WP_002263367.1 | hypothetical protein | - |
| AB1F71_RS08680 (AB1F71_08680) | - | 1756447..1756650 (+) | 204 | WP_002263366.1 | hypothetical protein | - |
| AB1F71_RS08685 (AB1F71_08685) | mutY | 1757687..1758832 (+) | 1146 | WP_002263365.1 | A/G-specific adenine glycosylase | - |
| AB1F71_RS08690 (AB1F71_08690) | - | 1759020..1760069 (-) | 1050 | WP_002263364.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| AB1F71_RS08695 (AB1F71_08695) | trxA | 1760167..1760481 (-) | 315 | WP_002263363.1 | thioredoxin | - |
| AB1F71_RS08700 (AB1F71_08700) | - | 1760556..1762886 (-) | 2331 | WP_002263362.1 | endonuclease MutS2 | - |
| AB1F71_RS08705 (AB1F71_08705) | - | 1762955..1763500 (-) | 546 | WP_002263361.1 | CvpA family protein | - |
| AB1F71_RS08710 (AB1F71_08710) | - | 1763497..1763802 (-) | 306 | WP_002263360.1 | hypothetical protein | - |
| AB1F71_RS08715 (AB1F71_08715) | rnhC | 1763998..1764909 (+) | 912 | WP_002271343.1 | ribonuclease HIII | - |
| AB1F71_RS08720 (AB1F71_08720) | lepB | 1764929..1765516 (+) | 588 | WP_002263358.1 | signal peptidase I | - |
| AB1F71_RS08725 (AB1F71_08725) | - | 1765602..1767965 (+) | 2364 | WP_002263357.1 | ATP-dependent RecD-like DNA helicase | - |
| AB1F71_RS08730 (AB1F71_08730) | - | 1768064..1768534 (+) | 471 | WP_002263356.1 | hypothetical protein | - |
| AB1F71_RS08735 (AB1F71_08735) | - | 1769411..1770403 (+) | 993 | WP_002263355.1 | PTS sugar transporter subunit IIB | - |
| AB1F71_RS08740 (AB1F71_08740) | - | 1770438..1771256 (+) | 819 | WP_002263354.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
| AB1F71_RS08745 (AB1F71_08745) | - | 1771271..1772197 (+) | 927 | WP_002263353.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| AB1F71_RS08750 (AB1F71_08750) | comA/nlmT | 1772529..1774820 (-) | 2292 | WP_002263352.1 | peptide cleavage/export ABC transporter | Regulator |
| AB1F71_RS08755 (AB1F71_08755) | - | 1775370..1775723 (-) | 354 | WP_002263351.1 | hypothetical protein | - |
| AB1F71_RS08760 (AB1F71_08760) | - | 1776042..1776410 (+) | 369 | WP_002263350.1 | DUF956 family protein | - |
| AB1F71_RS08765 (AB1F71_08765) | - | 1776647..1777720 (-) | 1074 | WP_002263349.1 | acyltransferase | - |
| AB1F71_RS08770 (AB1F71_08770) | serS | 1778244..1779524 (+) | 1281 | WP_002263348.1 | serine--tRNA ligase | - |
| AB1F71_RS08775 (AB1F71_08775) | - | 1780207..1780470 (-) | 264 | WP_002352361.1 | Blp family class II bacteriocin | - |
| AB1F71_RS08780 (AB1F71_08780) | - | 1780774..1780959 (-) | 186 | WP_002263346.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| AB1F71_RS08790 (AB1F71_08790) | - | 1782536..1782697 (-) | 162 | WP_002263734.1 | Blp family class II bacteriocin | - |
| AB1F71_RS08795 (AB1F71_08795) | - | 1782742..1782996 (-) | 255 | WP_002263733.1 | Blp family class II bacteriocin | - |
| AB1F71_RS08800 (AB1F71_08800) | - | 1783384..1785569 (+) | 2186 | Protein_1686 | peptide cleavage/export ABC transporter | - |
| AB1F71_RS08805 (AB1F71_08805) | comB | 1785582..1786595 (+) | 1014 | WP_002263739.1 | HlyD family efflux transporter periplasmic adaptor subunit | Regulator |
| AB1F71_RS08810 (AB1F71_08810) | - | 1786857..1787000 (-) | 144 | WP_002263740.1 | hypothetical protein | - |
| AB1F71_RS08815 (AB1F71_08815) | - | 1787292..1788314 (-) | 1023 | WP_002263742.1 | thioredoxin family protein | - |
| AB1F71_RS08820 (AB1F71_08820) | - | 1788800..1788988 (-) | 189 | WP_002263743.1 | Blp family class II bacteriocin | - |
| AB1F71_RS08825 (AB1F71_08825) | - | 1789152..1789364 (-) | 213 | WP_002263744.1 | Blp family class II bacteriocin | - |
| AB1F71_RS08830 (AB1F71_08830) | - | 1789769..1789933 (-) | 165 | WP_002265308.1 | hypothetical protein | - |
| AB1F71_RS08835 (AB1F71_08835) | - | 1790373..1790585 (+) | 213 | Protein_1693 | IS3 family transposase | - |
| AB1F71_RS08840 (AB1F71_08840) | - | 1790708..1791112 (-) | 405 | WP_002263912.1 | hypothetical protein | - |
| AB1F71_RS08845 (AB1F71_08845) | - | 1791259..1791678 (-) | 420 | WP_002263913.1 | hypothetical protein | - |
| AB1F71_RS08850 (AB1F71_08850) | - | 1793059..1793460 (-) | 402 | WP_002310604.1 | hypothetical protein | - |
| AB1F71_RS08855 (AB1F71_08855) | cipB | 1793591..1793821 (-) | 231 | WP_002265368.1 | Blp family class II bacteriocin | Regulator |
| AB1F71_RS08860 (AB1F71_08860) | comC/blpC | 1794088..1794228 (+) | 141 | WP_002267610.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| AB1F71_RS08865 (AB1F71_08865) | comD/blpH | 1794370..1795695 (-) | 1326 | WP_002262113.1 | GHKL domain-containing protein | Regulator |
| AB1F71_RS08870 (AB1F71_08870) | comE/blpR | 1795692..1796444 (-) | 753 | WP_002262114.1 | response regulator transcription factor | Regulator |
| AB1F71_RS08875 (AB1F71_08875) | - | 1796916..1797554 (-) | 639 | WP_002262115.1 | VTT domain-containing protein | - |
| AB1F71_RS08880 (AB1F71_08880) | - | 1797601..1798227 (-) | 627 | WP_002262116.1 | hypothetical protein | - |
| AB1F71_RS08885 (AB1F71_08885) | der | 1798302..1799612 (-) | 1311 | WP_002262117.1 | ribosome biogenesis GTPase Der | - |
| AB1F71_RS08890 (AB1F71_08890) | dnaI | 1799625..1800524 (-) | 900 | WP_002262118.1 | primosomal protein DnaI | - |
| AB1F71_RS08895 (AB1F71_08895) | - | 1800525..1801694 (-) | 1170 | WP_002262119.1 | DnaD domain protein | - |
| AB1F71_RS08900 (AB1F71_08900) | nrdR | 1801681..1802172 (-) | 492 | WP_002262120.1 | transcriptional regulator NrdR | - |
| AB1F71_RS08905 (AB1F71_08905) | covR | 1802542..1803234 (-) | 693 | WP_002262121.1 | response regulator GcrR | Regulator |
| AB1F71_RS08910 (AB1F71_08910) | - | 1803591..1804127 (-) | 537 | WP_002262122.1 | YceD family protein | - |
| AB1F71_RS08915 (AB1F71_08915) | - | 1804120..1804695 (-) | 576 | WP_002262123.1 | TetR/AcrR family transcriptional regulator | - |
| AB1F71_RS08920 (AB1F71_08920) | - | 1804803..1805510 (+) | 708 | WP_002262124.1 | ABC transporter ATP-binding protein | - |
| AB1F71_RS08925 (AB1F71_08925) | - | 1805512..1808124 (+) | 2613 | WP_002263841.1 | ABC transporter permease | - |
| AB1F71_RS08930 (AB1F71_08930) | htpX | 1808261..1809160 (-) | 900 | WP_002262126.1 | zinc metalloprotease HtpX | - |
| AB1F71_RS08935 (AB1F71_08935) | - | 1809170..1809730 (-) | 561 | WP_002262127.1 | LemA family protein | - |
| AB1F71_RS08940 (AB1F71_08940) | rsmG | 1809818..1810531 (+) | 714 | WP_002262128.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| AB1F71_RS08945 (AB1F71_08945) | - | 1810755..1811588 (-) | 834 | WP_002262129.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
| AB1F71_RS08950 (AB1F71_08950) | - | 1811581..1813257 (-) | 1677 | WP_002262130.1 | ABC transporter ATP-binding protein | - |
| AB1F71_RS08955 (AB1F71_08955) | - | 1813286..1813831 (-) | 546 | WP_002262131.1 | ECF-type riboflavin transporter substrate-binding protein | - |
| AB1F71_RS08960 (AB1F71_08960) | - | 1813841..1814686 (-) | 846 | WP_002262132.1 | S-adenosyl-l-methionine hydroxide adenosyltransferase family protein | - |
| AB1F71_RS08965 (AB1F71_08965) | - | 1814810..1815586 (-) | 777 | WP_002262133.1 | carbon-nitrogen family hydrolase | - |
| AB1F71_RS08970 (AB1F71_08970) | - | 1815654..1816343 (-) | 690 | WP_002262134.1 | methionine ABC transporter permease | - |
| AB1F71_RS08975 (AB1F71_08975) | - | 1816345..1817409 (-) | 1065 | WP_002262135.1 | methionine ABC transporter ATP-binding protein | - |
| AB1F71_RS08980 (AB1F71_08980) | - | 1817402..1818775 (-) | 1374 | WP_002262136.1 | M20/M25/M40 family metallo-hydrolase | - |
Sequence
Protein
Download Length: 250 a.a. Molecular weight: 29358.71 Da Isoelectric Point: 8.2551
>NTDB_id=1020700 AB1F71_RS08870 WP_002262114.1 1795692..1796444(-) (comE/blpR) [Streptococcus mutans strain UA159 ykuR deletion]
MISIFVLEDDFLQQGRLETTIAAIMKEKNWSYKELTIFGKPQQLIDAIPEKGNHQIFFLDIEIKKEEKKGLEVANQIRQH
NPSAVIVFVTTHSEFMPLTFQYQVSALDFIDKSLNPEEFSHRIESALYYAMENSQKNGQSEELFIFHSSETQFQVPFAEI
LYFETSSTAHKLCLYTYDERIEFYGSMTDIVKMDKRLFQCHRSFIVNPANITRIDRKKRLAYFRNNKSCLISRTKLTKLR
AVIADQRRAK
MISIFVLEDDFLQQGRLETTIAAIMKEKNWSYKELTIFGKPQQLIDAIPEKGNHQIFFLDIEIKKEEKKGLEVANQIRQH
NPSAVIVFVTTHSEFMPLTFQYQVSALDFIDKSLNPEEFSHRIESALYYAMENSQKNGQSEELFIFHSSETQFQVPFAEI
LYFETSSTAHKLCLYTYDERIEFYGSMTDIVKMDKRLFQCHRSFIVNPANITRIDRKKRLAYFRNNKSCLISRTKLTKLR
AVIADQRRAK
Nucleotide
Download Length: 753 bp
>NTDB_id=1020700 AB1F71_RS08870 WP_002262114.1 1795692..1796444(-) (comE/blpR) [Streptococcus mutans strain UA159 ykuR deletion]
ATGATTTCTATTTTTGTATTGGAAGATGATTTTTTACAACAAGGACGTCTTGAAACCACCATTGCAGCTATCATGAAAGA
AAAAAATTGGTCTTATAAAGAATTGACTATTTTTGGAAAACCACAACAACTTATTGACGCTATCCCTGAAAAGGGCAATC
ACCAGATTTTCTTTTTGGATATTGAAATCAAAAAAGAGGAAAAGAAAGGACTGGAAGTAGCCAATCAGATTAGACAGCAT
AATCCTAGTGCAGTTATTGTCTTTGTCACGACACATTCTGAGTTTATGCCCCTCACTTTTCAGTATCAGGTATCTGCTTT
GGATTTTATTGATAAATCTTTGAATCCTGAGGAGTTCTCCCACCGCATTGAATCAGCGCTGTATTATGCTATGGAAAACA
GCCAGAAGAATGGTCAATCAGAGGAACTTTTTATTTTCCATTCATCTGAAACTCAGTTTCAGGTCCCTTTTGCTGAGATT
CTGTATTTTGAAACATCTTCAACAGCCCATAAGCTCTGCCTTTATACTTATGATGAACGGATTGAATTCTACGGCAGTAT
GACTGACATTGTTAAAATGGATAAGAGACTTTTTCAGTGCCATCGCTCTTTTATTGTCAATCCTGCCAATATTACCCGTA
TTGATCGGAAAAAACGCTTGGCCTATTTTCGAAATAATAAGTCTTGTCTTATTTCACGAACTAAGTTAACAAAACTGAGA
GCTGTGATTGCTGATCAAAGGAGAGCAAAATGA
ATGATTTCTATTTTTGTATTGGAAGATGATTTTTTACAACAAGGACGTCTTGAAACCACCATTGCAGCTATCATGAAAGA
AAAAAATTGGTCTTATAAAGAATTGACTATTTTTGGAAAACCACAACAACTTATTGACGCTATCCCTGAAAAGGGCAATC
ACCAGATTTTCTTTTTGGATATTGAAATCAAAAAAGAGGAAAAGAAAGGACTGGAAGTAGCCAATCAGATTAGACAGCAT
AATCCTAGTGCAGTTATTGTCTTTGTCACGACACATTCTGAGTTTATGCCCCTCACTTTTCAGTATCAGGTATCTGCTTT
GGATTTTATTGATAAATCTTTGAATCCTGAGGAGTTCTCCCACCGCATTGAATCAGCGCTGTATTATGCTATGGAAAACA
GCCAGAAGAATGGTCAATCAGAGGAACTTTTTATTTTCCATTCATCTGAAACTCAGTTTCAGGTCCCTTTTGCTGAGATT
CTGTATTTTGAAACATCTTCAACAGCCCATAAGCTCTGCCTTTATACTTATGATGAACGGATTGAATTCTACGGCAGTAT
GACTGACATTGTTAAAATGGATAAGAGACTTTTTCAGTGCCATCGCTCTTTTATTGTCAATCCTGCCAATATTACCCGTA
TTGATCGGAAAAAACGCTTGGCCTATTTTCGAAATAATAAGTCTTGTCTTATTTCACGAACTAAGTTAACAAAACTGAGA
GCTGTGATTGCTGATCAAAGGAGAGCAAAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE/blpR | Streptococcus mutans UA159 |
100 |
100 |
1 |
| comE/comE1 | Streptococcus equinus JB1 |
46.888 |
96.4 |
0.452 |
| comE | Streptococcus mitis NCTC 12261 |
41.7 |
98.8 |
0.412 |
| comE | Streptococcus infantis strain Atu-4 |
41.7 |
98.8 |
0.412 |
| comE | Streptococcus pneumoniae D39 |
41.296 |
98.8 |
0.408 |
| comE | Streptococcus pneumoniae Rx1 |
41.296 |
98.8 |
0.408 |
| comE | Streptococcus pneumoniae R6 |
41.296 |
98.8 |
0.408 |
| comE | Streptococcus pneumoniae TIGR4 |
41.296 |
98.8 |
0.408 |
| comE | Streptococcus mitis SK321 |
41.296 |
98.8 |
0.408 |
| comE/comE2 | Streptococcus equinus JB1 |
40.664 |
96.4 |
0.392 |
| comE/comE1 | Streptococcus gordonii str. Challis substr. CH1 |
37.551 |
98 |
0.368 |
| comE/comE2 | Streptococcus gordonii strain NCTC7865 |
37.551 |
98 |
0.368 |