Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AB1F71_RS08855 Genome accession   NZ_CP160386
Coordinates   1793591..1793821 (-) Length   76 a.a.
NCBI ID   WP_002265368.1    Uniprot ID   Q8DS95
Organism   Streptococcus mutans strain UA159 ykuR deletion     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1740347..1819739 1793591..1793821 within 0


Gene organization within MGE regions


Location: 1740347..1819739
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F71_RS08585 (AB1F71_08585) - 1740478..1741917 (+) 1440 WP_002262658.1 sucrose-6-phosphate hydrolase -
  AB1F71_RS08590 (AB1F71_08590) - 1741920..1742882 (+) 963 WP_002262659.1 LacI family DNA-binding transcriptional regulator -
  AB1F71_RS08595 (AB1F71_08595) nusB 1743076..1743504 (-) 429 WP_002262660.1 transcription antitermination factor NusB -
  AB1F71_RS08600 (AB1F71_08600) - 1743497..1743886 (-) 390 WP_002262661.1 Asp23/Gls24 family envelope stress response protein -
  AB1F71_RS08605 (AB1F71_08605) efp 1743929..1744489 (-) 561 WP_002262662.1 elongation factor P -
  AB1F71_RS08610 (AB1F71_08610) - 1744629..1745333 (+) 705 WP_002262663.1 ion transporter -
  AB1F71_RS08615 (AB1F71_08615) - 1745381..1745833 (-) 453 WP_002262664.1 deaminase -
  AB1F71_RS08620 (AB1F71_08620) - 1746003..1747067 (-) 1065 WP_002262665.1 Xaa-Pro peptidase family protein -
  AB1F71_RS08625 (AB1F71_08625) uvrA 1747057..1749888 (-) 2832 WP_002262666.1 excinuclease ABC subunit UvrA -
  AB1F71_RS08630 (AB1F71_08630) - 1749938..1750159 (+) 222 WP_019313410.1 hypothetical protein -
  AB1F71_RS08635 (AB1F71_08635) - 1750559..1751503 (+) 945 WP_002262667.1 magnesium transporter CorA family protein -
  AB1F71_RS08640 (AB1F71_08640) - 1751785..1752447 (+) 663 WP_002262668.1 DUF1129 domain-containing protein -
  AB1F71_RS08645 (AB1F71_08645) hdrR 1752586..1752942 (+) 357 WP_002262669.1 LytTR family transcriptional regulator HdrR Regulator
  AB1F71_RS08650 (AB1F71_08650) hdrM 1752939..1753625 (+) 687 WP_002262670.1 hdrR negative regulator HdrM Regulator
  AB1F71_RS08655 (AB1F71_08655) - 1753633..1754352 (-) 720 WP_002262671.1 TraX family protein -
  AB1F71_RS08660 (AB1F71_08660) rpsR 1754671..1754910 (-) 240 WP_000068664.1 30S ribosomal protein S18 -
  AB1F71_RS08665 (AB1F71_08665) ssbA 1754939..1755433 (-) 495 WP_002261867.1 single-stranded DNA-binding protein Machinery gene
  AB1F71_RS08670 (AB1F71_08670) rpsF 1755451..1755741 (-) 291 WP_002261866.1 30S ribosomal protein S6 -
  AB1F71_RS08675 (AB1F71_08675) - 1755897..1756142 (-) 246 WP_002263367.1 hypothetical protein -
  AB1F71_RS08680 (AB1F71_08680) - 1756447..1756650 (+) 204 WP_002263366.1 hypothetical protein -
  AB1F71_RS08685 (AB1F71_08685) mutY 1757687..1758832 (+) 1146 WP_002263365.1 A/G-specific adenine glycosylase -
  AB1F71_RS08690 (AB1F71_08690) - 1759020..1760069 (-) 1050 WP_002263364.1 zinc-dependent alcohol dehydrogenase family protein -
  AB1F71_RS08695 (AB1F71_08695) trxA 1760167..1760481 (-) 315 WP_002263363.1 thioredoxin -
  AB1F71_RS08700 (AB1F71_08700) - 1760556..1762886 (-) 2331 WP_002263362.1 endonuclease MutS2 -
  AB1F71_RS08705 (AB1F71_08705) - 1762955..1763500 (-) 546 WP_002263361.1 CvpA family protein -
  AB1F71_RS08710 (AB1F71_08710) - 1763497..1763802 (-) 306 WP_002263360.1 hypothetical protein -
  AB1F71_RS08715 (AB1F71_08715) rnhC 1763998..1764909 (+) 912 WP_002271343.1 ribonuclease HIII -
  AB1F71_RS08720 (AB1F71_08720) lepB 1764929..1765516 (+) 588 WP_002263358.1 signal peptidase I -
  AB1F71_RS08725 (AB1F71_08725) - 1765602..1767965 (+) 2364 WP_002263357.1 ATP-dependent RecD-like DNA helicase -
  AB1F71_RS08730 (AB1F71_08730) - 1768064..1768534 (+) 471 WP_002263356.1 hypothetical protein -
  AB1F71_RS08735 (AB1F71_08735) - 1769411..1770403 (+) 993 WP_002263355.1 PTS sugar transporter subunit IIB -
  AB1F71_RS08740 (AB1F71_08740) - 1770438..1771256 (+) 819 WP_002263354.1 PTS mannose/fructose/sorbose transporter subunit IIC -
  AB1F71_RS08745 (AB1F71_08745) - 1771271..1772197 (+) 927 WP_002263353.1 PTS system mannose/fructose/sorbose family transporter subunit IID -
  AB1F71_RS08750 (AB1F71_08750) comA/nlmT 1772529..1774820 (-) 2292 WP_002263352.1 peptide cleavage/export ABC transporter Regulator
  AB1F71_RS08755 (AB1F71_08755) - 1775370..1775723 (-) 354 WP_002263351.1 hypothetical protein -
  AB1F71_RS08760 (AB1F71_08760) - 1776042..1776410 (+) 369 WP_002263350.1 DUF956 family protein -
  AB1F71_RS08765 (AB1F71_08765) - 1776647..1777720 (-) 1074 WP_002263349.1 acyltransferase -
  AB1F71_RS08770 (AB1F71_08770) serS 1778244..1779524 (+) 1281 WP_002263348.1 serine--tRNA ligase -
  AB1F71_RS08775 (AB1F71_08775) - 1780207..1780470 (-) 264 WP_002352361.1 Blp family class II bacteriocin -
  AB1F71_RS08780 (AB1F71_08780) - 1780774..1780959 (-) 186 WP_002263346.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  AB1F71_RS08790 (AB1F71_08790) - 1782536..1782697 (-) 162 WP_002263734.1 Blp family class II bacteriocin -
  AB1F71_RS08795 (AB1F71_08795) - 1782742..1782996 (-) 255 WP_002263733.1 Blp family class II bacteriocin -
  AB1F71_RS08800 (AB1F71_08800) - 1783384..1785569 (+) 2186 Protein_1686 peptide cleavage/export ABC transporter -
  AB1F71_RS08805 (AB1F71_08805) comB 1785582..1786595 (+) 1014 WP_002263739.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator
  AB1F71_RS08810 (AB1F71_08810) - 1786857..1787000 (-) 144 WP_002263740.1 hypothetical protein -
  AB1F71_RS08815 (AB1F71_08815) - 1787292..1788314 (-) 1023 WP_002263742.1 thioredoxin family protein -
  AB1F71_RS08820 (AB1F71_08820) - 1788800..1788988 (-) 189 WP_002263743.1 Blp family class II bacteriocin -
  AB1F71_RS08825 (AB1F71_08825) - 1789152..1789364 (-) 213 WP_002263744.1 Blp family class II bacteriocin -
  AB1F71_RS08830 (AB1F71_08830) - 1789769..1789933 (-) 165 WP_002265308.1 hypothetical protein -
  AB1F71_RS08835 (AB1F71_08835) - 1790373..1790585 (+) 213 Protein_1693 IS3 family transposase -
  AB1F71_RS08840 (AB1F71_08840) - 1790708..1791112 (-) 405 WP_002263912.1 hypothetical protein -
  AB1F71_RS08845 (AB1F71_08845) - 1791259..1791678 (-) 420 WP_002263913.1 hypothetical protein -
  AB1F71_RS08850 (AB1F71_08850) - 1793059..1793460 (-) 402 WP_002310604.1 hypothetical protein -
  AB1F71_RS08855 (AB1F71_08855) cipB 1793591..1793821 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  AB1F71_RS08860 (AB1F71_08860) comC/blpC 1794088..1794228 (+) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  AB1F71_RS08865 (AB1F71_08865) comD/blpH 1794370..1795695 (-) 1326 WP_002262113.1 GHKL domain-containing protein Regulator
  AB1F71_RS08870 (AB1F71_08870) comE/blpR 1795692..1796444 (-) 753 WP_002262114.1 response regulator transcription factor Regulator
  AB1F71_RS08875 (AB1F71_08875) - 1796916..1797554 (-) 639 WP_002262115.1 VTT domain-containing protein -
  AB1F71_RS08880 (AB1F71_08880) - 1797601..1798227 (-) 627 WP_002262116.1 hypothetical protein -
  AB1F71_RS08885 (AB1F71_08885) der 1798302..1799612 (-) 1311 WP_002262117.1 ribosome biogenesis GTPase Der -
  AB1F71_RS08890 (AB1F71_08890) dnaI 1799625..1800524 (-) 900 WP_002262118.1 primosomal protein DnaI -
  AB1F71_RS08895 (AB1F71_08895) - 1800525..1801694 (-) 1170 WP_002262119.1 DnaD domain protein -
  AB1F71_RS08900 (AB1F71_08900) nrdR 1801681..1802172 (-) 492 WP_002262120.1 transcriptional regulator NrdR -
  AB1F71_RS08905 (AB1F71_08905) covR 1802542..1803234 (-) 693 WP_002262121.1 response regulator GcrR Regulator
  AB1F71_RS08910 (AB1F71_08910) - 1803591..1804127 (-) 537 WP_002262122.1 YceD family protein -
  AB1F71_RS08915 (AB1F71_08915) - 1804120..1804695 (-) 576 WP_002262123.1 TetR/AcrR family transcriptional regulator -
  AB1F71_RS08920 (AB1F71_08920) - 1804803..1805510 (+) 708 WP_002262124.1 ABC transporter ATP-binding protein -
  AB1F71_RS08925 (AB1F71_08925) - 1805512..1808124 (+) 2613 WP_002263841.1 ABC transporter permease -
  AB1F71_RS08930 (AB1F71_08930) htpX 1808261..1809160 (-) 900 WP_002262126.1 zinc metalloprotease HtpX -
  AB1F71_RS08935 (AB1F71_08935) - 1809170..1809730 (-) 561 WP_002262127.1 LemA family protein -
  AB1F71_RS08940 (AB1F71_08940) rsmG 1809818..1810531 (+) 714 WP_002262128.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  AB1F71_RS08945 (AB1F71_08945) - 1810755..1811588 (-) 834 WP_002262129.1 energy-coupling factor transporter transmembrane protein EcfT -
  AB1F71_RS08950 (AB1F71_08950) - 1811581..1813257 (-) 1677 WP_002262130.1 ABC transporter ATP-binding protein -
  AB1F71_RS08955 (AB1F71_08955) - 1813286..1813831 (-) 546 WP_002262131.1 ECF-type riboflavin transporter substrate-binding protein -
  AB1F71_RS08960 (AB1F71_08960) - 1813841..1814686 (-) 846 WP_002262132.1 S-adenosyl-l-methionine hydroxide adenosyltransferase family protein -
  AB1F71_RS08965 (AB1F71_08965) - 1814810..1815586 (-) 777 WP_002262133.1 carbon-nitrogen family hydrolase -
  AB1F71_RS08970 (AB1F71_08970) - 1815654..1816343 (-) 690 WP_002262134.1 methionine ABC transporter permease -
  AB1F71_RS08975 (AB1F71_08975) - 1816345..1817409 (-) 1065 WP_002262135.1 methionine ABC transporter ATP-binding protein -
  AB1F71_RS08980 (AB1F71_08980) - 1817402..1818775 (-) 1374 WP_002262136.1 M20/M25/M40 family metallo-hydrolase -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7262.08 Da        Isoelectric Point: 3.7781

>NTDB_id=1020697 AB1F71_RS08855 WP_002265368.1 1793591..1793821(-) (cipB) [Streptococcus mutans strain UA159 ykuR deletion]
MNTQAFEQFNVMDNEALSAVEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=1020697 AB1F71_RS08855 WP_002265368.1 1793591..1793821(-) (cipB) [Streptococcus mutans strain UA159 ykuR deletion]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTGTTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DS95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

100

100

1


Multiple sequence alignment