Detailed information
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU63_RS05415 | Genome accession | NZ_CP155987 |
| Coordinates | 1282111..1282539 (+) | Length | 142 a.a. |
| NCBI ID | WP_057671660.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain LMG 08081 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1234786..1291160 | 1282111..1282539 | within | 0 |
Gene organization within MGE regions
Location: 1234786..1291160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU63_RS05200 (ABFU63_05195) | - | 1234786..1236666 (+) | 1881 | WP_019237331.1 | integrase arm-type DNA-binding domain-containing protein | - |
| ABFU63_RS05205 (ABFU63_05200) | - | 1236851..1237270 (+) | 420 | WP_019237332.1 | hypothetical protein | - |
| ABFU63_RS05210 (ABFU63_05205) | - | 1237303..1238304 (+) | 1002 | WP_407365473.1 | XVIPCD domain-containing protein | - |
| ABFU63_RS05215 (ABFU63_05210) | - | 1238375..1239025 (-) | 651 | WP_011038252.1 | LysR substrate-binding domain-containing protein | - |
| ABFU63_RS05220 (ABFU63_05215) | - | 1239128..1239421 (+) | 294 | WP_011038251.1 | helix-turn-helix domain-containing protein | - |
| ABFU63_RS05225 (ABFU63_05220) | - | 1239449..1240333 (-) | 885 | WP_057671621.1 | LysR family transcriptional regulator | - |
| ABFU63_RS05230 (ABFU63_05225) | - | 1241086..1245111 (-) | 4026 | WP_075287146.1 | helix-turn-helix domain-containing protein | - |
| ABFU63_RS05235 (ABFU63_05230) | - | 1245659..1248922 (-) | 3264 | WP_057671623.1 | ATP-binding protein | - |
| ABFU63_RS05240 (ABFU63_05235) | - | 1249013..1249144 (+) | 132 | Protein_1012 | IS5/IS1182 family transposase | - |
| ABFU63_RS05245 (ABFU63_05240) | - | 1250113..1251651 (+) | 1539 | WP_011038243.1 | MASE1 domain-containing protein | - |
| ABFU63_RS05250 (ABFU63_05245) | - | 1252673..1253320 (+) | 648 | WP_016848927.1 | hypothetical protein | - |
| ABFU63_RS05255 (ABFU63_05250) | - | 1253352..1254491 (+) | 1140 | WP_017117946.1 | type IV secretion system protein | - |
| ABFU63_RS05260 (ABFU63_05255) | - | 1254569..1255108 (+) | 540 | WP_225443876.1 | DUF4189 domain-containing protein | - |
| ABFU63_RS05265 (ABFU63_05260) | - | 1255506..1256036 (+) | 531 | WP_407365474.1 | hypothetical protein | - |
| ABFU63_RS05270 (ABFU63_05265) | - | 1256033..1256692 (+) | 660 | WP_057671625.1 | hypothetical protein | - |
| ABFU63_RS05275 (ABFU63_05270) | - | 1256689..1258071 (+) | 1383 | WP_057671628.1 | DUF6792 domain-containing protein | - |
| ABFU63_RS05280 (ABFU63_05275) | - | 1258175..1258602 (+) | 428 | Protein_1020 | type IV secretion system protein | - |
| ABFU63_RS05285 (ABFU63_05280) | - | 1259031..1260163 (+) | 1133 | WP_139115401.1 | IS3-like element ISXca1 family transposase | - |
| ABFU63_RS05290 (ABFU63_05285) | - | 1260182..1260733 (+) | 552 | Protein_1022 | IS3 family transposase | - |
| ABFU63_RS05295 (ABFU63_05290) | - | 1261282..1261761 (+) | 480 | WP_075286085.1 | RadC family protein | - |
| ABFU63_RS05300 (ABFU63_05295) | - | 1261832..1262023 (+) | 192 | WP_221261829.1 | hypothetical protein | - |
| ABFU63_RS05305 (ABFU63_05300) | - | 1262657..1262812 (+) | 156 | WP_186009287.1 | hypothetical protein | - |
| ABFU63_RS05310 (ABFU63_05305) | - | 1263801..1264226 (+) | 426 | Protein_1026 | XVIPCD domain-containing protein | - |
| ABFU63_RS05315 (ABFU63_05310) | - | 1264254..1264508 (-) | 255 | WP_057671639.1 | hypothetical protein | - |
| ABFU63_RS05320 (ABFU63_05315) | - | 1264775..1266370 (+) | 1596 | WP_192012501.1 | MobA/MobL family protein | - |
| ABFU63_RS05325 (ABFU63_05320) | - | 1266443..1266811 (-) | 369 | WP_225443877.1 | transcriptional regulator | - |
| ABFU63_RS05330 (ABFU63_05325) | - | 1266819..1267100 (-) | 282 | WP_011348355.1 | DUF6516 family protein | - |
| ABFU63_RS05335 (ABFU63_05330) | - | 1267166..1267507 (-) | 342 | WP_081020748.1 | hypothetical protein | - |
| ABFU63_RS05340 (ABFU63_05335) | - | 1268233..1268583 (+) | 351 | WP_225443878.1 | hypothetical protein | - |
| ABFU63_RS05345 (ABFU63_05340) | - | 1268882..1269112 (-) | 231 | WP_157382680.1 | hypothetical protein | - |
| ABFU63_RS05350 (ABFU63_05345) | - | 1269176..1269322 (+) | 147 | WP_040940792.1 | hypothetical protein | - |
| ABFU63_RS05355 (ABFU63_05350) | - | 1269507..1269902 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU63_RS05360 (ABFU63_05355) | - | 1269993..1270385 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU63_RS05365 (ABFU63_05360) | glgX | 1270920..1273049 (-) | 2130 | WP_057671651.1 | glycogen debranching protein GlgX | - |
| ABFU63_RS05370 (ABFU63_05365) | rimK | 1273542..1274417 (+) | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU63_RS05375 (ABFU63_05370) | - | 1275067..1275744 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU63_RS05380 (ABFU63_05375) | - | 1275737..1277071 (+) | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU63_RS05385 (ABFU63_05380) | - | 1277214..1277705 (-) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| ABFU63_RS05390 (ABFU63_05385) | - | 1277702..1277992 (-) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU63_RS05395 (ABFU63_05390) | - | 1278067..1278468 (-) | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| ABFU63_RS05400 (ABFU63_05395) | coaE | 1279000..1279623 (-) | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| ABFU63_RS05405 (ABFU63_05400) | - | 1279637..1280500 (-) | 864 | WP_057671659.1 | A24 family peptidase | - |
| ABFU63_RS05410 (ABFU63_05405) | pilC | 1280507..1281769 (-) | 1263 | WP_057671824.1 | type II secretion system F family protein | Machinery gene |
| ABFU63_RS05415 (ABFU63_05410) | pilA | 1282111..1282539 (+) | 429 | WP_057671660.1 | pilin | Machinery gene |
| ABFU63_RS05420 (ABFU63_05415) | pilB | 1282675..1284405 (+) | 1731 | WP_057671826.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU63_RS05430 (ABFU63_05425) | pilR | 1284824..1286218 (-) | 1395 | WP_057671663.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU63_RS05435 (ABFU63_05430) | - | 1286427..1288037 (-) | 1611 | WP_057671664.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU63_RS05440 (ABFU63_05435) | sucC | 1288271..1289440 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU63_RS05445 (ABFU63_05440) | sucD | 1289465..1290340 (+) | 876 | WP_057671668.1 | succinate--CoA ligase subunit alpha | - |
| ABFU63_RS05450 (ABFU63_05445) | - | 1290444..1290854 (+) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFU63_RS05455 (ABFU63_05450) | - | 1290858..1291160 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 14272.35 Da Isoelectric Point: 9.1206
>NTDB_id=1000773 ABFU63_RS05415 WP_057671660.1 1282111..1282539(+) (pilA) [Xanthomonas campestris pv. campestris strain LMG 08081]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
Nucleotide
Download Length: 429 bp
>NTDB_id=1000773 ABFU63_RS05415 WP_057671660.1 1282111..1282539(+) (pilA) [Xanthomonas campestris pv. campestris strain LMG 08081]
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Ralstonia pseudosolanacearum GMI1000 |
52.201 |
100 |
0.585 |
| pilA2 | Legionella pneumophila str. Paris |
54.795 |
100 |
0.563 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.795 |
100 |
0.563 |
| comP | Acinetobacter baylyi ADP1 |
47.771 |
100 |
0.528 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
39.247 |
100 |
0.514 |
| pilA/pilA1 | Eikenella corrodens VA1 |
40 |
100 |
0.437 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.541 |
100 |
0.423 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
40.136 |
100 |
0.415 |
| pilA | Acinetobacter baumannii strain A118 |
40.426 |
99.296 |
0.401 |
| pilA | Vibrio cholerae C6706 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae strain A1552 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
33.766 |
100 |
0.366 |