Detailed information of effector


Summary

Effector ID EFF01495 experimental
Effector type Tre
Cognate immunity protein IMU00317 experimental; IMU00330 experimental; IMU00331 experimental; IMU00332 experimental
Related T6SS (Type) T6SS00234 insolico (Type i3)
Strain Serratia proteamaculans 568
Replicon chromosome
Sequence Protein sequence (445 a.a.); Nucleotide sequence (1335 bp)
Description Tre1 (type VI secretion ADP-ribosyltransferase effector 1), contains an N-terminal PAAR domain,h the toxicity of Tre1 deriving from its ART-like domain.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Spro_3017 (Tre1)
Coordinates (Strand) 3321185..3322519 (+)
NCBI ID 157371257
RefSeq NC_009832
Uniprot ID UPI0000E791AD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ART PF01129.20 1.3e-15 274..441
PAAR_motif PF05488.15 3.3e-14 72..140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-19 MSELSAARELDEIAHTASE
Transmembrane helix 20-39 GWMIAGLIGGAIVGAALIAV
Outside 40-43 TGGT
Transmembrane helix 44-66 AAVAVAAVVAGASAGGGLGEVLG
Inside 67-178 SMSWAPRHVTGVLADGSPNVYINGRPAIRAHISTGECSEDGPAKKVVAQGSAKVYINDFPAARINDLLACSAEIHTGSPNVIIGGEKEQTDDIEPEIPDWVNWTLLAAGAGA
Transmembrane helix 179-201 AAVLATPAIAILGTLGGLGGGFA
Outside 202-444 GSLIGGAFFGEGSDGQKWSMLAGGFVGGFAGGKGGAKFDAWRNTKIVEPPPRVTTKVDPISPPRMTLAEAVGQEQAKVWTQTARANAEKNNAQLSTLLTDDQIGAIYGYTTNEGYTALNPALRGQTPLTPELEAFTGHVTDGLNKLPAYNGETYRGTTLPAHILEQNQIGGTVSDGGFMSTSAKTPFDGDVSISVRGNSGKQIDFLSKYKNEAEVLYPPNTRFEVINRIEQNGTTHLLYREIP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8037 - -



  Protein sequence: 445 a.a.    .

>EFF01495 NC_009832:3321185-3322519 [Serratia proteamaculans 568]
MSELSAARELDEIAHTASEGWMIAGLIGGAIVGAALIAVTGGTAAVAVAAVVAGASAGGGLGEVLGSMSWAPRHVTGVLA
DGSPNVYINGRPAIRAHISTGECSEDGPAKKVVAQGSAKVYINDFPAARINDLLACSAEIHTGSPNVIIGGEKEQTDDIE
PEIPDWVNWTLLAAGAGAAAVLATPAIAILGTLGGLGGGFAGSLIGGAFFGEGSDGQKWSMLAGGFVGGFAGGKGGAKFD
AWRNTKIVEPPPRVTTKVDPISPPRMTLAEAVGQEQAKVWTQTARANAEKNNAQLSTLLTDDQIGAIYGYTTNEGYTALN
PALRGQTPLTPELEAFTGHVTDGLNKLPAYNGETYRGTTLPAHILEQNQIGGTVSDGGFMSTSAKTPFDGDVSISVRGNS
GKQIDFLSKYKNEAEVLYPPNTRFEVINRIEQNGTTHLLYREIP*

  Nucleotide sequence: 1335 bp    .

>EFF01495 NC_009832:3321185-3322519 [Serratia proteamaculans 568]
ATGAGTGAGCTTAGTGCAGCGCGCGAGTTGGATGAAATAGCCCACACTGCGTCCGAAGGCTGGATGATCGCCGGTTTGAT
TGGCGGCGCGATTGTCGGTGCCGCACTAATCGCCGTTACTGGTGGCACGGCGGCGGTCGCTGTCGCAGCCGTAGTTGCAG
GCGCTTCTGCCGGAGGCGGGCTTGGTGAAGTGCTGGGCAGCATGTCCTGGGCACCTCGCCATGTCACCGGGGTACTTGCC
GATGGCTCGCCGAATGTCTACATCAATGGTAGACCTGCCATACGCGCGCATATCTCAACAGGAGAATGCAGTGAAGATGG
CCCGGCCAAAAAGGTCGTTGCTCAAGGCTCAGCCAAAGTCTATATCAATGATTTCCCTGCGGCCCGTATCAATGATTTGC
TGGCATGTAGCGCCGAAATTCACACCGGTTCACCTAACGTCATTATTGGCGGAGAAAAAGAGCAAACGGATGATATTGAA
CCAGAGATCCCCGACTGGGTGAACTGGACGCTGCTTGCGGCGGGTGCCGGTGCCGCTGCCGTGCTCGCCACCCCTGCCAT
AGCGATACTGGGTACGCTGGGCGGATTGGGAGGCGGTTTCGCAGGCAGTTTAATTGGCGGGGCTTTCTTCGGTGAAGGCA
GTGATGGTCAGAAATGGTCAATGCTGGCGGGAGGATTCGTCGGCGGATTTGCCGGTGGCAAAGGCGGTGCCAAGTTTGAT
GCTTGGCGTAATACGAAAATCGTCGAACCTCCACCTCGGGTCACTACAAAAGTAGACCCCATTTCTCCGCCCCGTATGAC
TCTGGCAGAGGCTGTAGGCCAAGAACAAGCGAAGGTGTGGACACAAACGGCAAGGGCCAATGCTGAAAAGAATAACGCTC
AGTTGTCAACCTTGCTCACTGATGACCAAATAGGCGCCATTTACGGTTATACGACTAATGAAGGCTACACAGCATTAAAT
CCAGCATTACGAGGACAAACACCATTGACTCCAGAACTTGAGGCTTTTACTGGACATGTAACTGATGGGCTCAATAAGTT
GCCTGCTTACAACGGGGAGACATATCGCGGAACGACATTACCAGCACATATTTTGGAACAAAATCAGATTGGCGGCACCG
TTTCAGATGGCGGTTTCATGAGTACGTCGGCAAAAACTCCTTTTGACGGTGACGTTAGCATCTCGGTACGAGGAAACTCA
GGTAAACAAATTGACTTTTTGTCAAAGTATAAAAACGAAGCAGAGGTTCTATATCCTCCGAATACTCGGTTTGAAGTTAT
TAATCGCATAGAGCAAAATGGCACAACACATCTTTTATACAGGGAAATTCCATGA