Detailed information NTG0994790

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: EW029_RS07960
• Genome accession: NZ_LR130513
• Coordinates: 1609894..1610205 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: A0A0H2XGS7
• Organism: Staphylococcus aureus strain BPH2900 isolate BPH2900
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1604894..1615205

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EW029_RS07925	gcvPA	1605396..1606742 (-)	1347	WP_000019688.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
EW029_RS07930	gcvT	1606762..1607853 (-)	1092	WP_000093355.1	glycine cleavage system aminomethyltransferase GcvT	-
EW029_RS07935	-	1608012..1608536 (-)	525	WP_001015122.1	shikimate kinase	-
EW029_RS07940	-	1608526..1608672 (-)	147	WP_001789879.1	hypothetical protein	-
EW029_RS07945	comGF	1608769..1609266 (-)	498	WP_029697681.1	competence type IV pilus minor pilin ComGF	Machinery gene
EW029_RS07950	comGE	1609184..1609483 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
EW029_RS07955	comGD	1609470..1609916 (-)	447	WP_075583651.1	competence type IV pilus minor pilin ComGD	Machinery gene
EW029_RS07960	comGC	1609894..1610205 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
EW029_RS07965	comGB	1610219..1611289 (-)	1071	WP_000776403.1	competence type IV pilus assembly protein ComGB	Machinery gene
EW029_RS07970	comGA	1611261..1612235 (-)	975	WP_000697215.1	competence type IV pilus ATPase ComGA	Machinery gene
EW029_RS07975	-	1612287..1612910 (-)	624	WP_001223006.1	MBL fold metallo-hydrolase	-
EW029_RS07980	-	1612907..1613236 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
EW029_RS07985	-	1613236..1614222 (-)	987	WP_000161315.1	ROK family glucokinase	-
EW029_RS07990	-	1614219..1614422 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=994790 EW029_RS07960 WP_000472256.1 1609894..1610205(-) (comGC) [Staphylococcus aureus strain BPH2900 isolate BPH2900]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=994790 EW029_RS07960 WP_000472256.1 1609894..1610205(-) (comGC) [Staphylococcus aureus strain BPH2900 isolate BPH2900]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0H2XGS7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369