Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AAVB98_RS13785 | Genome accession | NZ_CP154895 |
| Coordinates | 2644309..2644449 (+) | Length | 46 a.a. |
| NCBI ID | WP_013353398.1 | Uniprot ID | P06532 |
| Organism | Bacillus amyloliquefaciens strain Fad 77 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2639309..2649449
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAVB98_RS13755 (AAVB98_13755) | - | 2639318..2639566 (+) | 249 | WP_013353404.1 | YueH family protein | - |
| AAVB98_RS13760 (AAVB98_13760) | - | 2639632..2640027 (+) | 396 | WP_013353403.1 | DUF1694 domain-containing protein | - |
| AAVB98_RS13765 (AAVB98_13765) | - | 2640108..2640659 (+) | 552 | WP_013353402.1 | isochorismatase family cysteine hydrolase | - |
| AAVB98_RS13770 (AAVB98_13770) | - | 2640677..2642143 (+) | 1467 | WP_014472199.1 | nicotinate phosphoribosyltransferase | - |
| AAVB98_RS13775 (AAVB98_13775) | - | 2642273..2643496 (+) | 1224 | WP_013353400.1 | EAL and HDOD domain-containing protein | - |
| AAVB98_RS13780 (AAVB98_13780) | - | 2643503..2643844 (-) | 342 | WP_013353399.1 | hypothetical protein | - |
| AAVB98_RS13785 (AAVB98_13785) | degQ | 2644309..2644449 (+) | 141 | WP_013353398.1 | degradation enzyme regulation protein DegQ | Regulator |
| AAVB98_RS13790 (AAVB98_13790) | - | 2644601..2645476 (+) | 876 | WP_013353397.1 | polyprenyl synthetase family protein | - |
| AAVB98_RS13795 (AAVB98_13795) | comX | 2645495..2645671 (+) | 177 | WP_013353396.1 | competence pheromone ComX | - |
| AAVB98_RS13800 (AAVB98_13800) | comP | 2645694..2648000 (+) | 2307 | WP_013353395.1 | histidine kinase | Regulator |
| AAVB98_RS13805 (AAVB98_13805) | comA | 2648081..2648725 (+) | 645 | WP_345816777.1 | response regulator transcription factor | Regulator |
| AAVB98_RS13810 (AAVB98_13810) | - | 2648747..2649130 (+) | 384 | WP_013353393.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5532.37 Da Isoelectric Point: 6.2567
>NTDB_id=994789 AAVB98_RS13785 WP_013353398.1 2644309..2644449(+) (degQ) [Bacillus amyloliquefaciens strain Fad 77]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=994789 AAVB98_RS13785 WP_013353398.1 2644309..2644449(+) (degQ) [Bacillus amyloliquefaciens strain Fad 77]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
91.304 |
100 |
0.913 |