Detailed information NTG0993039

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: E0E15_RS08250
• Genome accession: NZ_LR027870
• Coordinates: 1632504..1632815 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: A0A0H2XGS7
• Organism: Staphylococcus aureus strain BPH2019 isolate BPH2019
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1627504..1637815

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E0E15_RS08215	gcvPA	1628007..1629353 (-)	1347	WP_000019684.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
E0E15_RS08220	gcvT	1629373..1630464 (-)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-
E0E15_RS08225	-	1630623..1631147 (-)	525	WP_116100530.1	shikimate kinase	-
E0E15_RS08230	-	1631137..1631282 (-)	146	Protein_1544	hypothetical protein	-
E0E15_RS08235	comGF	1631379..1631876 (-)	498	WP_001803317.1	competence type IV pilus minor pilin ComGF	Machinery gene
E0E15_RS08240	comGE	1631794..1632093 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
E0E15_RS08245	comGD	1632080..1632526 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
E0E15_RS08250	comGC	1632504..1632815 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
E0E15_RS08260	-	1632984..1634156 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
E0E15_RS08265	comGB	1634140..1635231 (-)	1092	WP_130827171.1	competence type IV pilus assembly protein ComGB	Machinery gene
E0E15_RS08270	comGA	1635203..1636177 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
E0E15_RS08275	-	1636229..1636852 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
E0E15_RS08280	-	1636849..1637178 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=993039 E0E15_RS08250 WP_000472256.1 1632504..1632815(-) (comGC) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=993039 E0E15_RS08250 WP_000472256.1 1632504..1632815(-) (comGC) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0H2XGS7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369