Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACOCJA_RS02325 | Genome accession | NZ_CP184565 |
| Coordinates | 433726..434037 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain CBTW2018043 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 428726..439037
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOCJA_RS02295 (ACOCJA_02295) | - | 429509..429712 (+) | 204 | WP_000087559.1 | YqgQ family protein | - |
| ACOCJA_RS02300 (ACOCJA_02300) | - | 429709..430695 (+) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| ACOCJA_RS02305 (ACOCJA_02305) | - | 430695..431024 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACOCJA_RS02310 (ACOCJA_02310) | - | 431021..431644 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACOCJA_RS02315 (ACOCJA_02315) | comGA | 431696..432670 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACOCJA_RS02320 (ACOCJA_02320) | comGB | 432642..433712 (+) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACOCJA_RS02325 (ACOCJA_02325) | comGC | 433726..434037 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACOCJA_RS02330 (ACOCJA_02330) | comGD | 434015..434461 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACOCJA_RS02335 (ACOCJA_02335) | comGE | 434448..434747 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACOCJA_RS02340 (ACOCJA_02340) | comGF | 434665..435162 (+) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACOCJA_RS02345 (ACOCJA_02345) | - | 435259..435405 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACOCJA_RS02350 (ACOCJA_02350) | - | 435395..435919 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| ACOCJA_RS02355 (ACOCJA_02355) | gcvT | 436078..437169 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACOCJA_RS02360 (ACOCJA_02360) | gcvPA | 437189..438535 (+) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=986919 ACOCJA_RS02325 WP_000472256.1 433726..434037(+) (comGC) [Staphylococcus aureus strain CBTW2018043]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=986919 ACOCJA_RS02325 WP_000472256.1 433726..434037(+) (comGC) [Staphylococcus aureus strain CBTW2018043]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |