Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | R8625_RS09820 | Genome accession | NZ_AP026923 |
| Coordinates | 1879489..1879905 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609561.1 | Uniprot ID | A0A237KAF1 |
| Organism | Streptococcus pneumoniae strain PZ900700054 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1849173..1903405 | 1879489..1879905 | within | 0 |
Gene organization within MGE regions
Location: 1849173..1903405
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8625_RS09605 (PC0054_18690) | - | 1849173..1850129 (-) | 957 | WP_219601358.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| R8625_RS09610 (PC0054_18700) | - | 1850133..1850465 (-) | 333 | WP_050085269.1 | phage holin | - |
| R8625_RS09615 (PC0054_18710) | - | 1850469..1850768 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| R8625_RS09620 (PC0054_18720) | - | 1850777..1851127 (-) | 351 | WP_000852245.1 | hypothetical protein | - |
| R8625_RS09625 (PC0054_18730) | - | 1851130..1851333 (-) | 204 | WP_001091109.1 | hypothetical protein | - |
| R8625_RS09630 | - | 1851314..1851430 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| R8625_RS09635 (PC0054_18740) | - | 1851427..1858692 (-) | 7266 | WP_317649160.1 | tail fiber domain-containing protein | - |
| R8625_RS09640 (PC0054_18750) | - | 1858697..1859047 (-) | 351 | WP_000068032.1 | DUF6711 family protein | - |
| R8625_RS09645 (PC0054_18760) | - | 1859056..1862709 (-) | 3654 | WP_277776316.1 | hypothetical protein | - |
| R8625_RS09650 (PC0054_18770) | - | 1862696..1863046 (-) | 351 | WP_000478011.1 | hypothetical protein | - |
| R8625_RS09655 (PC0054_18780) | - | 1863085..1863465 (-) | 381 | WP_001185637.1 | DUF6096 family protein | - |
| R8625_RS09660 (PC0054_18790) | - | 1863470..1863883 (-) | 414 | WP_000880666.1 | phage tail tube protein | - |
| R8625_RS09665 (PC0054_18800) | - | 1863886..1864254 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| R8625_RS09670 (PC0054_18810) | - | 1864251..1864766 (-) | 516 | WP_050202026.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| R8625_RS09675 (PC0054_18820) | - | 1864741..1865079 (-) | 339 | WP_000478945.1 | hypothetical protein | - |
| R8625_RS09680 (PC0054_18830) | - | 1865060..1865371 (-) | 312 | WP_000021222.1 | phage head-tail connector protein | - |
| R8625_RS09685 (PC0054_18840) | - | 1865373..1865561 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| R8625_RS09690 (PC0054_18850) | - | 1865571..1866596 (-) | 1026 | WP_000863391.1 | sugar-binding protein | - |
| R8625_RS09695 (PC0054_18860) | - | 1866619..1867134 (-) | 516 | WP_050168042.1 | DUF4355 domain-containing protein | - |
| R8625_RS09700 (PC0054_18870) | - | 1867302..1867553 (-) | 252 | WP_050204613.1 | DUF6275 family protein | - |
| R8625_RS09705 (PC0054_18880) | - | 1867555..1867813 (-) | 259 | Protein_1884 | hypothetical protein | - |
| R8625_RS09710 (PC0054_18890) | - | 1867958..1868131 (-) | 174 | WP_000379086.1 | hypothetical protein | - |
| R8625_RS09715 (PC0054_18900) | - | 1868182..1868409 (-) | 228 | WP_050168037.1 | hypothetical protein | - |
| R8625_RS09720 (PC0054_18910) | - | 1868397..1869800 (-) | 1404 | WP_225791266.1 | minor capsid protein | - |
| R8625_RS09725 (PC0054_18920) | - | 1869763..1871178 (-) | 1416 | WP_317649163.1 | phage portal protein | - |
| R8625_RS09730 (PC0054_18930) | - | 1871190..1872413 (-) | 1224 | WP_001864388.1 | PBSX family phage terminase large subunit | - |
| R8625_RS09735 (PC0054_18940) | - | 1872403..1872861 (-) | 459 | WP_061385061.1 | hypothetical protein | - |
| R8625_RS09740 (PC0054_18950) | - | 1872890..1874152 (-) | 1263 | WP_061632308.1 | DNA modification methylase | - |
| R8625_RS09750 (PC0054_18960) | - | 1874648..1875109 (-) | 462 | WP_001030245.1 | DUF1492 domain-containing protein | - |
| R8625_RS09755 (PC0054_18970) | - | 1875185..1875448 (-) | 264 | WP_050207369.1 | hypothetical protein | - |
| R8625_RS09760 (PC0054_18980) | - | 1875445..1875765 (-) | 321 | WP_001268497.1 | hypothetical protein | - |
| R8625_RS09765 (PC0054_18990) | - | 1875762..1876184 (-) | 423 | WP_317649164.1 | YopX family protein | - |
| R8625_RS09770 (PC0054_19000) | - | 1876181..1876375 (-) | 195 | WP_050200029.1 | hypothetical protein | - |
| R8625_RS09775 (PC0054_19010) | - | 1876372..1876632 (-) | 261 | WP_050200028.1 | DUF1372 family protein | - |
| R8625_RS09780 (PC0054_19020) | - | 1876629..1876793 (-) | 165 | WP_317649166.1 | hypothetical protein | - |
| R8625_RS09785 (PC0054_19030) | - | 1876790..1877485 (-) | 696 | WP_317649167.1 | DUF1642 domain-containing protein | - |
| R8625_RS09790 (PC0054_19040) | - | 1877487..1877804 (-) | 318 | WP_317649168.1 | hypothetical protein | - |
| R8625_RS09795 (PC0054_19050) | - | 1877829..1878011 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| R8625_RS09800 (PC0054_19060) | - | 1878027..1878458 (-) | 432 | WP_000779141.1 | RusA family crossover junction endodeoxyribonuclease | - |
| R8625_RS09805 (PC0054_19070) | - | 1878455..1878784 (-) | 330 | WP_288171468.1 | hypothetical protein | - |
| R8625_RS09810 (PC0054_19080) | - | 1878798..1879007 (-) | 210 | WP_050199665.1 | hypothetical protein | - |
| R8625_RS09815 (PC0054_19090) | - | 1878973..1879479 (-) | 507 | WP_000034832.1 | class I SAM-dependent methyltransferase | - |
| R8625_RS09820 (PC0054_19100) | ssbA | 1879489..1879905 (-) | 417 | WP_000609561.1 | single-stranded DNA-binding protein | Machinery gene |
| R8625_RS09825 (PC0054_19110) | - | 1879895..1880038 (-) | 144 | WP_153277088.1 | hypothetical protein | - |
| R8625_RS09830 (PC0054_19120) | - | 1880041..1881081 (-) | 1041 | WP_288171457.1 | DUF1351 domain-containing protein | - |
| R8625_RS09835 (PC0054_19130) | bet | 1881091..1881855 (-) | 765 | WP_000184008.1 | phage recombination protein Bet | - |
| R8625_RS09840 (PC0054_19140) | - | 1881867..1882097 (-) | 231 | WP_000192920.1 | hypothetical protein | - |
| R8625_RS09845 (PC0054_19150) | - | 1882217..1882360 (-) | 144 | WP_000196747.1 | hypothetical protein | - |
| R8625_RS09850 (PC0054_19160) | - | 1882353..1882607 (-) | 255 | WP_317649171.1 | hypothetical protein | - |
| R8625_RS09855 (PC0054_19170) | - | 1882600..1882806 (-) | 207 | WP_317649172.1 | hypothetical protein | - |
| R8625_RS09860 (PC0054_19180) | - | 1882806..1882967 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| R8625_RS09865 (PC0054_19200) | - | 1883185..1884039 (-) | 855 | WP_001198473.1 | ATP-binding protein | - |
| R8625_RS09870 (PC0054_19210) | - | 1884049..1884900 (-) | 852 | WP_050167223.1 | DnaD domain protein | - |
| R8625_RS09875 (PC0054_19220) | - | 1884897..1885124 (-) | 228 | WP_001125555.1 | helix-turn-helix transcriptional regulator | - |
| R8625_RS09880 (PC0054_19240) | - | 1885315..1885605 (-) | 291 | WP_001815531.1 | hypothetical protein | - |
| R8625_RS09885 (PC0054_19250) | - | 1885602..1885748 (-) | 147 | WP_000389580.1 | hypothetical protein | - |
| R8625_RS09890 (PC0054_19260) | - | 1886143..1886265 (-) | 123 | WP_000343850.1 | hypothetical protein | - |
| R8625_RS09895 (PC0054_19270) | - | 1886339..1886614 (-) | 276 | WP_001094372.1 | hypothetical protein | - |
| R8625_RS09900 (PC0054_19280) | - | 1886789..1887595 (+) | 807 | WP_054422885.1 | XRE family transcriptional regulator | - |
| R8625_RS09905 (PC0054_19290) | - | 1887597..1887797 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| R8625_RS09910 (PC0054_19300) | - | 1887971..1889416 (+) | 1446 | WP_024478469.1 | recombinase family protein | - |
| R8625_RS09920 (PC0054_19310) | comGB/cglB | 1889498..1890514 (-) | 1017 | WP_138028521.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| R8625_RS09925 (PC0054_19320) | comGA/cglA/cilD | 1890462..1891403 (-) | 942 | WP_016398028.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| R8625_RS09930 (PC0054_19330) | - | 1891479..1891844 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| R8625_RS09935 (PC0054_19340) | - | 1891995..1893053 (-) | 1059 | WP_000649473.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| R8625_RS09940 (PC0054_19350) | nagA | 1893216..1894367 (-) | 1152 | WP_001134454.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| R8625_RS09945 (PC0054_19360) | - | 1894520..1896337 (-) | 1818 | WP_317649173.1 | acyltransferase family protein | - |
| R8625_RS09950 (PC0054_19370) | tgt | 1896435..1897577 (-) | 1143 | WP_317649174.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| R8625_RS09955 (PC0054_19380) | - | 1897707..1898564 (+) | 858 | WP_001108863.1 | DUF975 family protein | - |
| R8625_RS09960 (PC0054_19390) | pcp | 1898592..1899236 (-) | 645 | Protein_1933 | pyroglutamyl-peptidase I | - |
| R8625_RS09965 (PC0054_19400) | - | 1899343..1899692 (-) | 350 | Protein_1934 | DUF1304 domain-containing protein | - |
| R8625_RS09970 | - | 1899692..1899795 (-) | 104 | Protein_1935 | transcriptional regulator | - |
| R8625_RS09975 (PC0054_19410) | - | 1900223..1901335 (-) | 1113 | WP_317649175.1 | LysM domain-containing protein | - |
| R8625_RS09980 (PC0054_19420) | - | 1901501..1902121 (-) | 621 | WP_001172823.1 | HAD family hydrolase | - |
| R8625_RS09985 (PC0054_19430) | - | 1902125..1903405 (-) | 1281 | WP_317649176.1 | MATE family efflux transporter | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15252.97 Da Isoelectric Point: 6.9800
>NTDB_id=98222 R8625_RS09820 WP_000609561.1 1879489..1879905(-) (ssbA) [Streptococcus pneumoniae strain PZ900700054]
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFQAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=98222 R8625_RS09820 WP_000609561.1 1879489..1879905(-) (ssbA) [Streptococcus pneumoniae strain PZ900700054]
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTCAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAATAATGTATCTAGTTT
ACAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTCAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.429 |
100 |
0.551 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.86 |
100 |
0.543 |
| ssbA | Streptococcus mutans UA159 |
46.377 |
100 |
0.464 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.377 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
76.812 |
0.399 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
93.478 |
0.391 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.476 |
76.087 |
0.384 |